CAZyme Information: P175DRAFT_0496768-t39_1-p1

Basic Information

• Species: Aspergillus ochraceoroseus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus ochraceoroseus
• CAZyme ID: P175DRAFT_0496768-t39_1-p1
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
615	MSFN02000014|CGC3	68622.56	9.3999

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AochraceoroseusIBT24754	9070	1392256	153	8917

• Gene Location: location=MSFN02000014:66125-68127(+)

Full Sequence      

MSTKAPYEIQELQPTQQMLAGLRYRKSLHFVAQAAVWTTDIYFLLRVGVVVTSLGQTWQM
WLMIMVEWIFARLSRQSQLLTVATGCKPPLLRKQLRLRGTKNLPRVDVLVACCGEPLDII
LDTVRAACSIDYPASEFRVLLLDDGGSEALRIAVSELQSKWPQLSYHTRGKHSGRVFAKA
GNLNFALFSLQEDFQPEYCVVLDSDCLPGRNFLRATLPHLLQNPQAALLTTRQHYYNLPQ
GDPLSQSRIHFYACHNTELDYQGIAIDAGSGAVFRRQVILDTGGYPTFSFSEDWQLSLIL
QGRGHTIIQVEEPLQFGLVPSSLQGHVAQRNRWNIGHSQQLNALRPPTNKSIPRQLQWSI
ALNGMQIVLGLVSSFVGFSTIPVLLLSDHLIPTPSPLLVKAQMAMAVTHMALTWLYAWLQ
AAYTGFRVPLFSHLENSWLAGTHLFAILRFQYFSSKPKGSFVTGSVANSWNRAGYASLCQ
KAQLLWENGVIYAVSLLLVTLSAAAFSIWRTITDDTGTLGTSFVTTLAWPPLLHIFYLAI
TNLWVPVSYLWNPPRYPDRASQLAKTEQGIAFPRAEVLGKLSFQGQYRSHGSGFAVVVVV
VPFLLVSLLIAVLAV

Enzyme Prediction     

No EC number prediction in P175DRAFT_0496768-t39_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	104	334	1.2e-18	0.9869565217391304

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133043	CESA_CelA_like	6.63e-84	104	341	1	234	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
224136	BcsA	1.04e-34	92	419	42	366	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
236918	bcsA	1.18e-23	89	339	244	490	cellulose synthase catalytic subunit; Provisional
133045	CESA_like	7.30e-22	108	293	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
133059	CESA_CaSu_A2	1.69e-19	126	336	22	231	Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex. Cellulose synthase (CESA) catalyzes the polymerization reaction of cellulose using UDP-glucose as the substrate. Cellulose is an aggregate of unbranched polymers of beta-1,4-linked glucose residues, which is an abundant polysaccharide produced by plants and in varying degrees by several other organisms including algae, bacteria, fungi, and even some animals. Genomes from higher plants harbor multiple CESA genes. There are ten in Arabidopsis. At least three different CESA proteins are required to form a functional complex. In Arabidopsis, CESA1, 3 and 6 and CESA4, 7 and 8, are required for cellulose biosynthesis during primary and secondary cell wall formation. CESA2 is very closely related to CESA6 and is viewed as a prime substitute for CESA6. They functionally compensate each other. The cesa2 and cesa6 double mutant plants were significantly smaller, while the single mutant plants were almost normal.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD81189.1|GT2	1.73e-244	8	564	8	567
BCS12365.1|GT2	1.40e-241	1	614	1	613
BCS00600.1|GT2	1.40e-241	1	614	1	613
QGA14290.1|GT2	7.03e-239	1	581	1	591
UDD54668.1|GT2	2.68e-236	8	577	8	580

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LBY_A	6.28e-26	89	352	257	516	Chain A, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]
5EJ1_A	8.79e-26	101	346	125	384	Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	9.98e-26	101	346	137	396	Chain A, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	9.99e-26	101	346	138	397	Chain A, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9RBJ2|BCSA4_KOMXY	6.24e-26	104	346	146	383	Putative cellulose synthase 2 OS=Komagataeibacter xylinus OX=28448 GN=bcsABII-A PE=3 SV=1
sp|Q9WX75|BCSA5_KOMXY	6.24e-26	104	346	146	383	Putative cellulose synthase 3 OS=Komagataeibacter xylinus OX=28448 GN=bcsABII-B PE=3 SV=1
sp|P58932|BCSA_XANAC	8.24e-26	89	339	137	383	Cellulose synthase catalytic subunit [UDP-forming] OS=Xanthomonas axonopodis pv. citri (strain 306) OX=190486 GN=bcsA PE=3 SV=1
sp|P37653|BCSA_ECOLI	3.18e-25	89	352	257	516	Cellulose synthase catalytic subunit [UDP-forming] OS=Escherichia coli (strain K12) OX=83333 GN=bcsA PE=1 SV=3
sp|Q8X5L7|BCSA_ECO57	4.22e-25	89	352	257	516	Cellulose synthase catalytic subunit [UDP-forming] OS=Escherichia coli O157:H7 OX=83334 GN=bcsA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000034	0.000001

TMHMM  Annotations     

Start	End
367	386
401	418
490	512
532	551
592	614