CAZyme Information: P175DRAFT_0492738-t39_1-p1

Basic Information

• Species: Aspergillus ochraceoroseus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus ochraceoroseus
• CAZyme ID: P175DRAFT_0492738-t39_1-p1
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
535	MSFN02000003|CGC4	56524.01	6.6477

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AochraceoroseusIBT24754	9070	1392256	153	8917

• Gene Location: location=MSFN02000003:2497120-2498858(+)

Full Sequence      

MHALSLFLLFLTPLLANGQLSGRVGPLTSSSSKAHTKTCNVLDYGAVADKSTDIGPAITS
AWNACAKGGVVYIPAGEYAMATWVTLSGGSACAIRLDGTIYRTGTGGGNMFMVKHTSDFE
FFSSTSKGAIQGYGYEFHAKGSTSGPRLLRLFDVTNFSVHDIALVDSPVFHLSLDTCTNG
EIYNMAIRGGNKGGLDGIDIWSTNIWVHDVYIPARCPANVEVTNKDECVTVKSPSKNVLV
ENIYCNWSGGCAMGSLGVDTDISDIVYRNIYTWNSNQMYMVKSNGGSGTVSNLVLENFIG
HGNAYSLDIDAHWSSMSTLAGAGVNVKNMTIRNWKGTETNGAQRGPIKVVCASGAPCTEV
TIEDFAMWTESGSRQTYWCENAFGSGFCLKESNSNSPYTTTLTATAAPSGYSAPRMPNDL
SSAFGTAREIPIPTIPTSFYPGATPYSALAGAASSSSATTKAKFAQGVSESETRSLPSST
TTTTTTTTTTTTTTSTTTTTTTTTATITSTLTATSSDEYPTHAHAHGCHGCRPHH

Enzyme Prediction     

EC	3.2.1.171:11

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	61	382	9.8e-48	0.9661538461538461

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395231	Glyco_hydro_28	1.24e-20	146	382	85	315	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
215540	PLN03010	3.40e-20	40	384	48	391	polygalacturonase
177865	PLN02218	7.94e-19	38	382	67	418	polygalacturonase ADPG
215120	PLN02188	1.25e-16	33	382	31	390	polygalacturonase/glycoside hydrolase family protein
165802	PLN02155	1.09e-14	40	384	29	380	polygalacturonase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABF50898.1|GH28|3.2.1.171	2.05e-268	5	456	4	445
BCS23384.1|GH28	1.48e-264	1	462	1	451
EAA61967.1|GH28|3.2.1.171	1.52e-256	5	456	4	455
QMW46234.1|GH28	1.69e-250	1	458	1	449
QMW34178.1|GH28	1.69e-250	1	458	1	449

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1RMG_A	1.38e-234	19	451	1	422	Rhamnogalacturonase A From Aspergillus Aculeatus [Aspergillus aculeatus]
4C2L_A	1.18e-18	49	381	26	373	Crystal structure of endo-xylogalacturonan hydrolase from Aspergillus tubingensis [Aspergillus tubingensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5ARE6|RHGA_EMENI	3.65e-269	5	456	4	445	Rhamnogalacturonase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=rhgA PE=2 SV=2
sp|B8NK45|RHGA_ASPFN	3.00e-251	1	458	1	449	Probable rhamnogalacturonase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=rhgA PE=3 SV=1
sp|Q2U293|RHGA_ASPOR	8.56e-251	1	458	1	449	Probable rhamnogalacturonase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=rhgA PE=3 SV=1
sp|Q00001|RHGA_ASPAC	8.83e-237	1	451	1	440	Rhamnogalacturonase A OS=Aspergillus aculeatus OX=5053 GN=rhgA PE=1 SV=1
sp|A2QYE5|RHGA_ASPNC	4.46e-236	1	455	1	445	Probable rhamnogalacturonase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rhgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000235	0.999722	CS pos: 18-19. Pr: 0.9824

TMHMM  Annotations     

There is no transmembrane helices in P175DRAFT_0492738-t39_1-p1.