CAZyme Information: P175DRAFT_0489907-t39_1-p1

Basic Information

• Species: Aspergillus ochraceoroseus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus ochraceoroseus
• CAZyme ID: P175DRAFT_0489907-t39_1-p1
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
799	MSFN02000001|CGC28	87437.78	5.0439

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AochraceoroseusIBT24754	9070	1392256	153	8917

• Gene Location: location=MSFN02000001:3474275-3477214(-)

Full Sequence      

MLSNRFSRGLVLLCAGLTAARGASPVYKDPNASIEDRISDLLGRMTVEDKMAQLIQGDVT
NWMNADTGDFNYTGLVENMKMKAGMFYGMVGYPVPWDWIATNVKKAQDYLIQNTTLGIPA
LVQTEGIHGFLIANATIFNSPIAYACSFNRDLVNKMGKIIAQEALTLGVNQLFGPVVDLA
RELRYGRVRIHYYTREKAQRSGLTAMQVEETFGEDPYLAGEIGYEYTTGLQSLNVSSTVK
HFIGFSEPEQGINTGPVKGGERYLRTTYFPSFKRAIVDAGAWSIMSAYHSYDGIPAVADY
HTLTEILRDEWGYEFYVISDAGATDRLCTAFHLCGSSPIDMESVTLQTLPAGNDVEMGGG
SFNFQKIPELVESGKLDIAAVNTAVSRVLRAKFTMGLFENPYPGAPHKEWEKLIHSKEAV
DLARKLDKESIVLLENHNNVLPLKKTGDIAVIGPMAHGFMNYGDYVVYRSQYRGVTPLDG
IKAAVGEKARVHYAQGCERWSNDQSGFPEAIEAAKNSDVAIVVVGTWSRDQRELWMGLNA
TTGEHVDTNDLSLVGAQGDLVKAIAATGVPTIVVLSSGKPISDSWLANGTTALIQQFYPS
EQGGNALADVLFGDYNPSGKLSVSFPRYVGDLPVYYDYLNSGRSIGDSGYETANGTLVFG
HQYVLGNPAPWYPFGYGKSYSEFEYGGVSLDKSHVSASDTVTVRVAVTNTHATLEGTEVV
QVYVVDEISTVDVPNRMLRGFEKVVIPPGNTETVQVQVRVQELGLWNTRMKYVVEPGAFQ
VLVGSSSADIRGNATFYVQ

Enzyme Prediction     

EC	3.2.1.120:1	3.2.1.21:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	112	357	8.1e-56	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	2.17e-155	13	796	4	762	beta-glucosidase BglX.
224389	BglX	4.90e-73	45	498	1	396	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
178629	PLN03080	4.96e-67	116	784	79	769	Probable beta-xylosidase; Provisional
396478	Glyco_hydro_3_C	2.75e-61	431	680	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	3.85e-53	46	391	1	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS20094.1|GH3	0.0	1	799	1	779
EAA63874.1|GH3	0.0	1	799	1	759
BAE62006.1|GH3|3.2.1.120	0.0	1	799	1	779
QMW32562.1|GH3	0.0	1	799	1	779
QMW44592.1|GH3	0.0	1	799	1	779

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7EAP_A	0.0	25	799	5	757	Chain A, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]
5YOT_A	0.0	25	799	5	757	Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
5Z87_A	1.98e-116	17	791	26	778	Chain A, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
5XXL_A	5.91e-109	36	791	11	745	Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	3.17e-108	36	791	11	745	Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|T2KMH0|PLH24_FORAG	3.32e-124	113	787	60	710	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
sp|Q56078|BGLX_SALTY	7.21e-119	38	791	38	758	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
sp|P33363|BGLX_ECOLI	1.08e-117	38	791	38	758	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
sp|T2KMH9|PLH34_FORAG	7.92e-98	27	791	29	748	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
sp|P14002|BGLB_ACET2	2.43e-89	116	790	35	660	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000462	0.999522	CS pos: 22-23. Pr: 0.9423

TMHMM  Annotations     

There is no transmembrane helices in P175DRAFT_0489907-t39_1-p1.