CAZyme Information: P175DRAFT_0488933-t39_1-p1

Basic Information

• Species: Aspergillus ochraceoroseus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus ochraceoroseus
• CAZyme ID: P175DRAFT_0488933-t39_1-p1
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
466	MSFN02000001|CGC13	51578.01	5.5953

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AochraceoroseusIBT24754	9070	1392256	153	8917

• Gene Location: location=MSFN02000001:318417-319979(-)

Full Sequence      

MKLLSLIALGATVVRGLAFDSLTQNTPPGAKVYHVSDVAGLAQIRGHHHKHPDRRTVTIR
ASRNDSDDISADFLWGIRRANHGGRLLLKKGETYVIGRKLDLRFLDNLEVQLDGELKFTD
DVPYWQANHFYYAFQKSISFWRWGGRDIKIFGTGVLNGNGQRWYNEFAGLEILVPLSLLA
FLVNEVNGFNVEKDSKNTYYRPILFLTENATRISVEGITQLNSPCWTNFFINTTDVSFDD
VFINAYSTNASAGKEKLMSQALPKNTDGFDSLNVNGLSVTNTRVDIGDDCFSPKPNTTNI
FVQNLWCNNTHGVSMGSIGQYAGVMDIIEHAYIENVTLLNGQNGARLKAWAGPNVGYGRI
NNITYKNIRIENTDHPVVLDQCYFDIPTEECAQYPSRVNVTNIVFEDIYGTSSGAEGAVV
ADLTCSPNAVCSNIHLENIDLSTPEGEGVIICDGIRGDIGVKCQAS

Enzyme Prediction     

EC	3.2.1.67:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	80	447	2.1e-65	0.92

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395231	Glyco_hydro_28	2.76e-36	97	442	14	304	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
215426	PLN02793	3.56e-32	256	447	217	400	Probable polygalacturonase
215120	PLN02188	4.95e-29	203	456	158	391	polygalacturonase/glycoside hydrolase family protein
165802	PLN02155	2.13e-26	248	446	177	368	polygalacturonase
177865	PLN02218	3.46e-26	152	441	164	408	polygalacturonase ADPG

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAO61898.1|GH28	3.91e-262	1	466	3	439
BCS21443.1|GH28	3.14e-256	1	466	1	437
EAA64105.1|GH28	2.19e-247	1	466	3	431
QRD92857.1|GH28	1.09e-246	6	466	5	433
QMW36166.1|GH28	1.09e-246	6	466	5	433

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C2L_A	4.65e-48	64	465	27	384	Crystal structure of endo-xylogalacturonan hydrolase from Aspergillus tubingensis [Aspergillus tubingensis]
1HG8_A	4.93e-17	145	411	68	304	Endopolygalacturonase from the phytopathogenic fungus Fusarium moniliforme [Fusarium verticillioides]
1NHC_A	4.06e-13	142	442	64	319	Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_B Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_C Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_D Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_E Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_F Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger]
1RMG_A	4.91e-12	147	457	79	355	Rhamnogalacturonase A From Aspergillus Aculeatus [Aspergillus aculeatus]
1BHE_A	2.94e-09	191	414	143	339	Chain A, POLYGALACTURONASE [Pectobacterium carotovorum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q873X6|PGXB_EMENI	6.95e-263	1	466	3	439	Probable exopolygalacturonase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pgxB PE=2 SV=1
sp|Q0C7H7|PGXB_ASPTN	2.62e-252	8	466	7	433	Probable exopolygalacturonase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pgxB PE=3 SV=1
sp|Q2TW03|PGXB_ASPOR	1.37e-247	6	466	5	433	Probable exopolygalacturonase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pgxB PE=3 SV=2
sp|B8NX60|PGXB_ASPFN	1.94e-247	6	466	5	433	Probable exopolygalacturonase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pgxB PE=3 SV=1
sp|A1DAX2|PGXB_NEOFI	1.78e-245	1	466	1	434	Probable exopolygalacturonase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pgxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000288	0.999676	CS pos: 16-17. Pr: 0.9792

TMHMM  Annotations     

There is no transmembrane helices in P175DRAFT_0488933-t39_1-p1.