CAZyme Information: P175DRAFT_0480213-t39_1-p1

Basic Information

• Species: Aspergillus ochraceoroseus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus ochraceoroseus
• CAZyme ID: P175DRAFT_0480213-t39_1-p1
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
328		35357.09	4.9601

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AochraceoroseusIBT24754	9070	1392256	153	8917

• Gene Location: location=MSFN02000005:48771-50049(-)

Full Sequence      

MHFLSFVCLASVAYAASRTTAPSGSIVVAKSGGHYDTISSAVSALSTTTTKTQIIYIEKG
TYAEQVYIPALEGELIIYGETEDTSTYSSNLVTITSGIGYPATKNDDKTATLRNHAKNSK
IYNINVKNTYGKGHQALALSAYGEYQGYYGCQFIGYQDTVLAEEGYQVYGKCLIEGAIDF
IFGQYSPAWFDSCDIRVVSGPTQGTITANGRVSSSGTSYFVINKSTIEAASGNSVSNGAY
YLGRPWSEYARVVFQETTMSSVIKSAGWIEWSSSTPNTEHVIFGEYGNSGDGSEGTRASF
ASKLRSAVSITTILGSDYKDWVDTDYLS

Enzyme Prediction     

EC	3.1.1.11:8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	26	305	3.4e-78	0.9409722222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395871	Pectinesterase	2.93e-51	26	293	2	266	Pectinesterase.
178051	PLN02432	3.05e-40	26	323	13	287	putative pectinesterase
215179	PLN02314	1.53e-39	19	297	273	544	pectinesterase
178087	PLN02468	7.28e-39	26	293	260	520	putative pectinesterase/pectinesterase inhibitor
215367	PLN02682	7.94e-39	11	318	56	366	pectinesterase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARB08121.1|CE8	2.56e-163	2	328	5	331
QKX54343.1|CE8	4.36e-154	3	328	5	328
CAK38387.1|CE8	2.75e-146	4	328	6	331
CAA02202.1|CE8|3.1.1.11	2.25e-145	4	328	6	331
CAA02198.1|CE8|3.1.1.11	2.25e-145	4	328	6	331

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1C_A	2.10e-73	17	326	2	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
5C1E_A	4.20e-73	17	326	2	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
1GQ8_A	2.87e-29	17	292	2	272	Pectin methylesterase from Carrot [Daucus carota]
1XG2_A	4.77e-24	27	292	6	268	Chain A, Pectinesterase 1 [Solanum lycopersicum]
4PMH_A	2.96e-11	32	292	45	365	The structure of rice weevil pectin methyl esterase [Sitophilus oryzae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P17872|PME_ASPNG	3.99e-146	4	328	6	331	Pectinesterase OS=Aspergillus niger OX=5061 GN=pme1 PE=1 SV=1
sp|Q12535|PME_ASPAC	8.31e-141	13	326	15	330	Pectinesterase OS=Aspergillus aculeatus OX=5053 GN=pme1 PE=2 SV=1
sp|Q5B7U0|PMEA_EMENI	1.34e-71	17	326	28	325	Pectinesterase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pmeA PE=1 SV=1
sp|B0Y9F9|PMEA_ASPFC	3.66e-71	17	326	27	324	Probable pectinesterase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pmeA PE=3 SV=1
sp|Q4WBT5|PMEA_ASPFU	3.66e-71	17	326	27	324	Probable pectinesterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pmeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000209	0.999754	CS pos: 15-16. Pr: 0.9836

TMHMM  Annotations     

There is no transmembrane helices in P175DRAFT_0480213-t39_1-p1.