CAZyme Information: P175DRAFT_0476034-t39_1-p1

Basic Information

• Species: Aspergillus ochraceoroseus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus ochraceoroseus
• CAZyme ID: P175DRAFT_0476034-t39_1-p1
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
455	MSFN02000002|CGC10	50698.94	4.4475

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AochraceoroseusIBT24754	9070	1392256	153	8917

• Gene Location: location=MSFN02000002:4034788-4036458(+)

Full Sequence      

MRWARLLSWGGAALLVLQGQLALADLTIDVNSADTLKQAGKDIAAPMMVFYAQNQTEGIP
GKLTDTWYVAGAMFMTLIQYWQASGDSQYNSIVSHDLMFQAGRNYDYFDSNYSQWLGNDD
QMFWGLAAMTASETGFPEVQDKPTWTSLARAVFNMQVGRWNSQSCGGGITWQIHPWQAGY
TLRNSISDGGLFQLAARLGRFTGNTTYLDWAEKLWNWSTQSPLINTHTWFVADSTSGDNN
CTDSGNMQWTYNYGTYLAGAAFMYNATNDEKWLTRVNGLLGRLESDFFPQTYGSVVLSEV
SCEGLQTCDRNMLCFKGWTAMWLAFTAQLAPTTQATILPKLQGSAEAIGRQCDGETDNLC
GSRWWQNTWDGIKGLEVQMSALGGITSNLMILTGTRAKTIQNNPNAKEQYLDTYSDDTPD
ALPTITTGDRVGSWILTVLWSLSIMAAAWWLMKQQ

Enzyme Prediction     

No EC number prediction in P175DRAFT_0476034-t39_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	34	392	2.2e-94	0.9329608938547486

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	1.87e-168	35	382	1	348	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
227170	COG4833	8.59e-04	111	336	82	287	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA66492.1|GH76	1.61e-250	1	455	1	464
EAA63620.1|GH76	1.66e-249	1	454	1	498
BCS18858.1|GH76	2.61e-232	1	455	1	461
QMW48345.1|GH76	1.73e-227	7	455	4	458
QRD92720.1|GH76	1.73e-227	7	455	4	458

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	4.24e-85	30	390	30	404	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P36091|DCW1_YEAST	2.56e-94	28	451	24	447	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
sp|Q6FLP9|DCW1_CANGA	3.60e-90	26	451	19	444	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
sp|Q75DG6|DCW1_ASHGO	3.63e-88	26	451	22	449	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=DCW1 PE=3 SV=2
sp|O74556|YCZ2_SCHPO	5.58e-88	26	391	20	386	Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.02 PE=3 SV=1
sp|Q5AD78|DCW1_CANAL	5.58e-84	28	451	21	450	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DCW1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000346	0.999614	CS pos: 24-25. Pr: 0.9754

TMHMM  Annotations     

Start	End
430	452