CAZyme Information: P175DRAFT_0473028-t39_1-p1

Basic Information

• Species: Aspergillus ochraceoroseus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus ochraceoroseus
• CAZyme ID: P175DRAFT_0473028-t39_1-p1
• CAZy Family: GH15|CBM20
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
593	MSFN02000002|CGC12	65412.23	5.8807

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AochraceoroseusIBT24754	9070	1392256	153	8917

• Gene Location: location=MSFN02000002:214831-216724(+)

Full Sequence      

MAQVSNGSQYDFIVVGGGTAGNTIAGRLAENPNVRVLVVEAGIAKPYEVEDITTPSKAFG
LRGSQYDWAYKTTMIKREDYERVEKPNTRGKALGGSSCANYFTWIPGSKATFDDWEEFGG
HEWKWDGCVDYLRKCATYHDDEKLYPAELSKIGTGGPLQISHAELVPEMQPFRDALTQAW
VSKGQLLSEDIYSGEMHGLTHCVDTIYKGQRQGSYLYVKDKPNVTILSGVQSRKLIIDKS
TRICSGVVTVNPVTGEEISVYAKREVIVSQGVFETPKLLMLSGIGPAKELAKHGIDVVLD
SPHVGQHLLDHPIVPFVLQIQDGYGLDDHLLRAGPLNEAAVSAYRRDKTGPVGSGLLELV
GFPRIDERLERYPAYREAKAANGGLDPFGPAGQPHFELDFVGMFSSAFQWHYPVPSQGNY
MTVIVDLLRPLSEGEVTLNSNNALVQPNINLNFFGSDLDILAMREGVRWTYDVLTNGAGF
KDIVVAEYPWTMPLNSDEAMNKAVLERSQTGFHPCGTARLSKSINQGVVDSKLRVHGIQN
LRIADASVIPVIPDCRIQNSVYMIGEKGADIIKSQHKDLYEAQNIPYFVPSKL

Enzyme Prediction     

No EC number prediction in P175DRAFT_0473028-t39_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	9	574	2.6e-148	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	8.20e-88	9	589	5	546	choline dehydrogenase; Validated
225186	BetA	2.50e-81	7	577	5	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	2.87e-42	430	567	1	142	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	8.31e-25	89	313	23	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	1.15e-21	8	565	54	569	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS26129.1|AA3_2	0.0	1	593	1	593
BCS00597.1|AA3_2	0.0	1	593	1	593
QKX58151.1|AA3_2	0.0	1	593	1	593
BCR87142.1|AA3_2	0.0	1	593	1	594
UNI24682.1|AA3_2	0.0	1	593	1	593

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3Q9T_A	1.94e-304	5	580	2	577	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	5.54e-304	5	580	2	577	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5ZU2_A	1.58e-303	5	580	2	577	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5OC1_A	6.05e-70	10	574	2	563	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	2.34e-69	8	574	1	564	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A9AMZ9|BETA_BURM1	1.79e-57	9	589	5	547	Oxygen-dependent choline dehydrogenase OS=Burkholderia multivorans (strain ATCC 17616 / 249) OX=395019 GN=betA PE=3 SV=1
sp|Q5GMY3|GMCH_MALSM	5.89e-55	6	572	43	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|M5EAX2|GMCH_MALS4	5.89e-55	6	572	43	615	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|Q0B711|BETA_BURCM	8.72e-55	9	589	5	547	Oxygen-dependent choline dehydrogenase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) OX=339670 GN=betA PE=3 SV=1
sp|B1Z034|BETA_BURA4	1.21e-54	9	589	5	547	Oxygen-dependent choline dehydrogenase OS=Burkholderia ambifaria (strain MC40-6) OX=398577 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999992	0.000045

TMHMM  Annotations     

There is no transmembrane helices in P175DRAFT_0473028-t39_1-p1.