CAZyme Information: P175DRAFT_0470786-t39_1-p1

Basic Information

• Species: Aspergillus ochraceoroseus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus ochraceoroseus
• CAZyme ID: P175DRAFT_0470786-t39_1-p1
• CAZy Family: GH13|CBM20
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
298	MSFN02000001|CGC24	32369.87	6.1539

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AochraceoroseusIBT24754	9070	1392256	153	8917

• Gene Location: location=MSFN02000001:2776352-2777326(-)

Full Sequence      

MRSLLVVLFSLYSSVIVSAFTPPALGERRNDAKTPLRILPLGASITWGQHSASGNGYRKP
LRDGLRYGGWEVDMVGSRNNGNMVDNDVEATDGYTIQEVANASLHSLPYKPNVVLIEAGT
NDCLLNDDIPKAGERMEELIHALIHATDMQQTAIVLATLLPSGNENIVKNRLSVNDQYRE
LVKALRKKNGISIVLADMDPPPPNGAHGWISYPTDFTAGGKTDEIHPNDYGYEKMAVIWN
KAITEAAASQGFIVKTASILPACPTPPIKGDRLPCLKDHIGDDDRQISNPGLPKMPPA

Enzyme Prediction     

No EC number prediction in P175DRAFT_0470786-t39_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	36	243	4.3e-53	0.9948453608247423

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	1.22e-35	36	243	1	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
404371	Lipase_GDSL_2	1.50e-18	41	234	2	176	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238141	SGNH_hydrolase	1.03e-13	38	236	1	181	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
238872	SGNH_hydrolase_like_2	7.02e-11	107	242	58	191	SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
239945	SGNH_hydrolase_like_4	2.71e-09	107	243	56	183	Members of the SGNH-hydrolase superfamily, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA66327.1|CE0	1.65e-78	28	264	50	281
EAA60916.1|CE0	1.24e-74	30	247	34	246
QRD87153.1|CE0	2.19e-74	33	253	44	261
UCK59306.1|CE0	2.19e-74	33	253	44	261
ABA65775.1|CE0	9.22e-69	28	259	50	264

PDB Hits     

P175DRAFT_0470786-t39_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9RLB8|CESA_RUMFL	1.95e-14	10	289	20	300	Multidomain esterase OS=Ruminococcus flavefaciens OX=1265 GN=cesA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000226	0.999756	CS pos: 26-27. Pr: 0.6405

TMHMM  Annotations     

There is no transmembrane helices in P175DRAFT_0470786-t39_1-p1.