CAZyme Information: P175DRAFT_0468443-t39_1-p1

Basic Information

• Species: Aspergillus ochraceoroseus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus ochraceoroseus
• CAZyme ID: P175DRAFT_0468443-t39_1-p1
• CAZy Family: GH132
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
507	MSFN02000001|CGC17	54399.19	4.2615

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AochraceoroseusIBT24754	9070	1392256	153	8917

• Gene Location: location=MSFN02000001:238833-240633(-)

Full Sequence      

MKLALVAAALVGTAFANIDPIIIKGSKFFYSSNNTQFYIRGVAYQQDYSSNGTTDGSTSY
IDPLSDVTTCKRDIPIMQDLNTNTIRVYAVDPTANHDECMSLLADAGIYVIADLSDPTQS
IDRNDPRWETSLYTRYTNVIDAFAGYKNTLGFFAGNEVSNTVSTTDASAFVKAAVRDMKA
YIKAKSYRSMGVGYATNDDSTIRVNMADYFNCGDTEDGIDFWGYNIYSWCGDSSYKVSGY
QERTEEFSNYSVPVFFAEYGCNEVQPRTFTEVKALFGDEMNDVWSGGIVYMYFQESNNYG
LVSVIDSTSVSKMTDYTYYSSEINAVSPTGTNKASYTPTNSALQDCPAVTSDWLATATPL
PPTPNSELCSCMNKAASCVVDSSVSSKDYADLFSVLCGLTSCAGVKANGTTGVYGAYGMC
TPEQQLNFVLNKYYSEQSSASTACDFSGSATITSAASATGTCSSMIKAAGTAGTGTVTTS
ASVSTTTSSSGAGRPRGLFINALAHLV

Enzyme Prediction     

EC	2.4.1.-:3	2.4.1.-:33

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH72	16	325	6.7e-139	0.9871794871794872
CBM43	377	463	3.4e-21	0.9879518072289156

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397351	Glyco_hydro_72	6.56e-169	10	327	1	315	Glucanosyltransferase. This is a family of glycosylphosphatidylinositol-anchored beta(1-3)glucanosyltransferases. The active site residues in the Aspergillus fumigatus example are the two glutamate residues at 160 and 261.
400371	X8	1.51e-24	387	451	12	76	X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains.
197867	X8	4.66e-16	387	464	12	85	Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAL84955.1|CBM43|GH72	6.99e-274	4	474	6	477
BAE66482.1|CBM43|GH72	2.51e-270	6	471	7	472
BCS21491.1|CBM43|GH72	1.42e-269	1	473	3	479
QRD92751.1|CBM43|GH72	2.92e-269	6	471	7	472
QMW36259.1|CBM43|GH72	2.92e-269	6	471	7	472

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2W62_A	1.35e-125	12	434	27	456	Saccharomyces cerevisiae Gas2p in complex with laminaripentaose [Saccharomyces cerevisiae],2W63_A Saccharomyces Cerevisiae Gas2p In Complex With Laminaritriose And Laminaritetraose [Saccharomyces cerevisiae],5O9O_A Crystal structure of ScGas2 in complex with compound 7. [Saccharomyces cerevisiae S288C],5O9P_A Crystal structure of Gas2 in complex with compound 10 [Saccharomyces cerevisiae S288C],5O9Q_A Crystal structure of ScGas2 in complex with compound 6 [Saccharomyces cerevisiae S288C],5O9R_A Crystal structure of ScGas2 in complex with compound 9 [Saccharomyces cerevisiae S288C],5O9Y_A Crystal structure of ScGas2 in complex with compound 11 [Saccharomyces cerevisiae S288C],5OA2_A Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA2_B Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA2_C Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA6_A Crystal structure of ScGas2 in complex with compound 12 [Saccharomyces cerevisiae S288C]
2W61_A	3.81e-125	12	434	27	456	Saccharomyces cerevisiae Gas2p apostructure (E176Q mutant) [Saccharomyces cerevisiae]
5FIH_A	3.81e-125	12	434	27	456	SACCHAROMYCES CEREVISIAE GAS2P (E176Q MUTANT) IN COMPLEX WITH LAMINARITETRAOSE AND LAMINARIPENTAOSE [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4ATC3|GAS1_ARTBC	1.70e-187	4	474	11	494	1,3-beta-glucanosyltransferase ARB_07487 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07487 PE=1 SV=1
sp|P0C956|GEL4_ASPFU	4.34e-186	8	472	10	489	1,3-beta-glucanosyltransferase gel4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gel4 PE=3 SV=1
sp|B0XVI5|GEL4_ASPFC	4.34e-186	8	472	10	489	1,3-beta-glucanosyltransferase gel4 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=gel4 PE=1 SV=1
sp|P56092|EPD1_CANMA	7.69e-177	5	473	11	472	Protein EPD1 OS=Candida maltosa OX=5479 GN=EPD1 PE=3 SV=1
sp|P0C955|GEL3_ASPFU	2.62e-176	22	474	17	473	1,3-beta-glucanosyltransferase gel3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gel3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000304	0.999678	CS pos: 16-17. Pr: 0.9805

TMHMM  Annotations     

There is no transmembrane helices in P175DRAFT_0468443-t39_1-p1.