CAZyme Information: P175DRAFT_0462882-t39_1-p1

Basic Information

• Species: Aspergillus ochraceoroseus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus ochraceoroseus
• CAZyme ID: P175DRAFT_0462882-t39_1-p1
• CAZy Family: GH13
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
458	MSFN02000006|CGC4	52253.10	6.3217

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AochraceoroseusIBT24754	9070	1392256	153	8917

• Gene Location: location=MSFN02000006:2082151-2083652(+)

Full Sequence      

MQIIWRDSADPAVYEEARIGRVFNHRRPRRYPLAVVKATRAEDVVKAIKLAAEKKCRVAV
RSGGHSWAAWSVRDESILIDLGNYKHLEVDPEKRIARASPSMTGREVNGKLVQEYGLMFP
GGHCPDVGLGGFLLQGGMGWNCRGWGWACERVKGVDVVTANGEILHCNQHQNADLYWAAR
GAGPGFPAVVTDYHLDLMTYPEKGFRSSAYLYTLDQYYEAFRWIISITPGFDRDTEIVAV
GLYPEGRDEICLFILLVTMKSTVEEAEKALAPAHQSRPEGAIEEWFCQEDSLENQYVKQA
NASPEKHRYCAENAYIENNADVPKVLEEAFTTLPHRKAFALWYAMNPCSQRQLPDMALSM
QSDHYFALYTVWEEENDDVRCQQWVRDVMKKVERKSVGAYLGDSDFQERKTRYWADSNGR
RLMDIRRKWDPTGRICGYLDPGDLSGIHGLDNAHEWKL

Enzyme Prediction     

EC	1.1.3.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	21	433	4.5e-76	0.9737991266375546

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396238	FAD_binding_4	3.42e-25	32	168	1	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
223354	GlcD	1.00e-24	16	434	16	449	FAD/FMN-containing dehydrogenase [Energy production and conversion].
215242	PLN02441	0.008	156	181	198	223	cytokinin dehydrogenase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UNI23960.1|AA7	7.79e-24	32	204	48	219
BAI44126.1|AA7|CBM18	6.28e-23	19	193	263	437
QBZ61916.1|AA7|CBM18	6.28e-23	19	193	263	437
QUC19098.1|AA7	8.56e-23	32	204	48	219
RDX44700.1|AA7|1.1.3.-	4.91e-22	32	217	69	249

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FYD_A	1.73e-31	2	432	21	450	The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_B The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_C The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_D The crystal structure of EncM T139V mutant [Streptomyces maritimus]
6FYG_A	4.42e-31	2	432	21	450	The crystal structure of EncM V135T mutant [Streptomyces maritimus],6FYG_B The crystal structure of EncM V135T mutant [Streptomyces maritimus],6FYG_C The crystal structure of EncM V135T mutant [Streptomyces maritimus],6FYG_D The crystal structure of EncM V135T mutant [Streptomyces maritimus]
6FYF_A	4.42e-31	2	432	21	450	The crystal structure of EncM V135M mutant [Streptomyces maritimus],6FYF_B The crystal structure of EncM V135M mutant [Streptomyces maritimus],6FYF_C The crystal structure of EncM V135M mutant [Streptomyces maritimus],6FYF_D The crystal structure of EncM V135M mutant [Streptomyces maritimus]
6FYB_A	6.04e-31	2	432	21	450	The crystal structure of EncM L144M mutant [Streptomyces maritimus],6FYB_B The crystal structure of EncM L144M mutant [Streptomyces maritimus],6FYB_C The crystal structure of EncM L144M mutant [Streptomyces maritimus],6FYB_D The crystal structure of EncM L144M mutant [Streptomyces maritimus],6FYC_A The crystal structure of EncM L144M mutant complex with dioxygen under 15 bars O2 pressure [Streptomyces maritimus],6FYC_B The crystal structure of EncM L144M mutant complex with dioxygen under 15 bars O2 pressure [Streptomyces maritimus]
6FYE_A	6.04e-31	2	432	21	450	The crystal structure of EncM H138T mutant [Streptomyces maritimus],6FYE_B The crystal structure of EncM H138T mutant [Streptomyces maritimus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A140JWT7|PTMO_PENSI	1.87e-101	4	441	12	444	FAD-linked oxidoreductase ptmO OS=Penicillium simplicissimum OX=69488 GN=ptmO PE=3 SV=1
sp|A0A0E3D8N0|JANO_PENJA	2.04e-100	1	439	6	443	FAD-linked oxidoreductase janO OS=Penicillium janthinellum OX=5079 GN=janO PE=3 SV=1
sp|A0A0E3D8N6|PENO_PENCR	2.97e-100	4	441	12	444	FAD-linked oxidoreductase penO OS=Penicillium crustosum OX=36656 GN=penO PE=3 SV=1
sp|A0A2I6PJ02|NODO_HYPPI	3.94e-100	1	439	9	444	FAD-linked oxidoreductase nodO OS=Hypoxylon pulicicidum OX=1243767 GN=nodO PE=3 SV=1
sp|A5ABH0|PYNB_ASPNC	2.41e-26	10	237	54	282	FAD-linked oxidoreductase pynB OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pynB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000064	0.000000

TMHMM  Annotations     

There is no transmembrane helices in P175DRAFT_0462882-t39_1-p1.