CAZyme Information: P175DRAFT_0460120-t39_1-p1

Basic Information

• Species: Aspergillus ochraceoroseus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus ochraceoroseus
• CAZyme ID: P175DRAFT_0460120-t39_1-p1
• CAZy Family: GH125
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
324	MSFN02000005|CGC17	33856.87	9.1003

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AochraceoroseusIBT24754	9070	1392256	153	8917

• Gene Location: location=MSFN02000005:760737-761844(-)

Full Sequence      

MPSIKWLLTVASCLGPVLAAPTATTQMNKRASANDAAFGFASLNGGTTGGGSGGTTTTVS
SYAQFTAAVANDEPKVVVVGGPITQAAKAVKVGSNTSILGKDSKAVLTGFGLLVKKKKNV
IIRNLGVKKVLAANGDAIAVQESTNVWIDHCDVSSDRDHDKDYYDGLLDVTHAADYVTIS
NTLIHDHWKASLVGHSDKNGAQDTGHLHITYANNHWANVNSRGPSIRFGTAHIYNNYFEN
VNHGVNTRDGAQVLVESNQFVGATKPLYSTDKGYAVAKDNDFGKGGGNQALAGTLTGVEY
KYSLVGSGKVKAAVVGTAGQTLTF

Enzyme Prediction     

EC	4.2.2.2:30

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	78	260	2.6e-90	0.994475138121547

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	2.63e-64	83	261	5	187	Amb_all domain.
226384	PelB	9.75e-51	31	319	24	340	Pectate lyase [Carbohydrate transport and metabolism].
366158	Pec_lyase_C	5.49e-42	90	260	30	211	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAX06687.1|PL1_7|4.2.2.2	1.54e-147	1	324	1	323
CAW62413.1|PL1_7|4.2.2.2	1.54e-147	1	324	1	323
CAX07544.1|PL1_7|4.2.2.2	1.54e-147	1	324	1	323
CAW50952.1|PL1_7|4.2.2.2	1.54e-147	1	324	1	323
CBC11543.1|PL1_7|4.2.2.2	1.54e-147	1	324	1	323

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VMV_A	1.34e-36	39	260	6	246	Crystal structure of pectate lyase Bsp165PelA from Bacillus sp. N165 [Bacillus sp. N16-5],3VMW_A Crystal structure of pectate lyase Bsp165PelA from Bacillus sp. N165 in complex with trigalacturonate [Bacillus sp. N16-5]
1PCL_A	5.01e-33	36	260	7	276	Chain A, PECTATE LYASE E [Dickeya chrysanthemi]
1VBL_A	2.70e-26	90	239	128	302	Structure of the thermostable pectate lyase PL 47 [Bacillus sp. TS-47]
1OOC_A	1.68e-24	60	239	39	258	Chain A, Pectate lyase A [Dickeya chrysanthemi],1OOC_B Chain B, Pectate lyase A [Dickeya chrysanthemi],1PE9_A Chain A, Pectate lyase A [Dickeya chrysanthemi],1PE9_B Chain B, Pectate lyase A [Dickeya chrysanthemi]
1JRG_A	1.57e-23	60	239	39	258	Chain A, Pectate lyase [Dickeya chrysanthemi],1JRG_B Chain B, Pectate lyase [Dickeya chrysanthemi],1JTA_A Chain A, pectate lyase A [Dickeya chrysanthemi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1CYB8|PLYA_NEOFI	5.18e-155	4	324	1	321	Probable pectate lyase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyA PE=3 SV=1
sp|Q4WIT0|PLYA_ASPFU	6.02e-154	4	324	1	321	Probable pectate lyase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyA PE=3 SV=1
sp|B0XT32|PLYA_ASPFC	6.02e-154	4	324	1	321	Probable pectate lyase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyA PE=3 SV=1
sp|Q9C2Z0|PLYA_ASPNG	2.73e-148	1	324	1	323	Pectate lyase A OS=Aspergillus niger OX=5061 GN=plyA PE=1 SV=1
sp|A2QV36|PLYA_ASPNC	3.87e-148	1	324	1	323	Probable pectate lyase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=plyA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000415	0.999552	CS pos: 30-31. Pr: 0.8310

TMHMM  Annotations     

There is no transmembrane helices in P175DRAFT_0460120-t39_1-p1.