CAZyme Information: P175DRAFT_0457358-t39_1-p1

Basic Information

• Species: Aspergillus ochraceoroseus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus ochraceoroseus
• CAZyme ID: P175DRAFT_0457358-t39_1-p1
• CAZy Family: GH11
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
402	MSFN02000003|CGC1	45489.83	5.7258

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AochraceoroseusIBT24754	9070	1392256	153	8917

• Gene Location: location=MSFN02000003:2224628-2226397(+)

Full Sequence      

MWTAPLLLLTTLFAWSPSVSATILQNGQPRDDPYPGQVPRIHLNDSWRSYGAGAPEIAYK
GRWDSKHISWWSAPGLKVQFSGEKLALSFGEHTSDGVLVAYRIGTLDWLFSNVTADSTYQ
FIGPGTAYEELPDEEDRVFELRVQIAGVSVDVDDYLIKPPTFRRKVEIIGGSITGGQYAT
YETLSSWAFIYAAGLGNVEFGITAYPGACLVDMQCYGGGVHGTIWYWHRASDPGSRARDM
YGSEPEEWNVQAEQPADLVIIQMGGNDHRHPNNIPGENFYQGYVDLIENIHHHWPGAEIV
LMTQWGAWAKKGARYEQSTIYEHEIQRVYEHFKDRRYAVHLFHTDGILGHNDINPKNHPT
DVGHIKIASHMLQWTTIKLGWGLHPTGEMQHGTLYWNDQQEY

Enzyme Prediction     

No EC number prediction in P175DRAFT_0457358-t39_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE2	165	372	2.9e-17	0.9808612440191388

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238869	Endoglucanase_E_like	3.24e-47	165	376	1	169	Endoglucanase E-like members of the SGNH hydrolase family; Endoglucanase E catalyzes the endohydrolysis of 1,4-beta-glucosidic linkages in cellulose, lichenin and cereal beta-D-glucans.
238141	SGNH_hydrolase	7.36e-13	166	373	1	186	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
404371	Lipase_GDSL_2	2.11e-09	233	364	42	174	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
225353	TesA	0.001	164	374	9	207	Lysophospholipase L1 or related esterase [Amino acid transport and metabolism].
238874	FeeA_FeeB_like	0.001	227	301	43	111	SGNH_hydrolase subfamily, FeeA, FeeB and similar esterases/lipases. FeeA and FeeB are part of a biosynthetic gene cluster and may participate in the biosynthesis of long-chain N-acyltyrosines by providing saturated and unsaturated fatty acids, which it turn are loaded onto the acyl carrier protein FeeL. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABF50860.1|CE0|3.1.1.-	6.69e-251	20	402	17	402
BCS23119.1|CE0	1.62e-239	1	402	1	409
EAA63262.1|CE0	8.21e-238	20	402	17	392
QQK40140.1|CE0	2.15e-197	9	402	7	407
QMW34907.1|CE0	5.83e-169	14	402	9	398

PDB Hits     

P175DRAFT_0457358-t39_1-p1 has no PDB hit.

Swiss-Prot Hits     

P175DRAFT_0457358-t39_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000196	0.999771	CS pos: 21-22. Pr: 0.9757

TMHMM  Annotations     

There is no transmembrane helices in P175DRAFT_0457358-t39_1-p1.