CAZyme Information: P175DRAFT_0454317-t39_1-p1

Basic Information

• Species: Aspergillus ochraceoroseus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus ochraceoroseus
• CAZyme ID: P175DRAFT_0454317-t39_1-p1
• CAZy Family: GH1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
845		91265.02	5.7782

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AochraceoroseusIBT24754	9070	1392256	153	8917

• Gene Location: location=MSFN02000002:2644994-2647736(+)

Full Sequence      

MGSNAETVQIDALLSRLTLEEKISLLAGKNFWETVDIPEKGIPSVKVSDGPNGARGAAFK
GGPTAACFPASCLLASTWDIEAAQKIGNALADETRSKGARALLGPTVCPHRHPLGGRNFE
SFSEDPFLAGKMAANYIHGVQEKGVAATIKHFAANEQETCRLTVNTHIAERTLREIYLKP
FEIAIKEANPQAVMTSYNIVNDTHADSNLFLLRDVLRGQWGWNGLVMSDWGGTNSTAESL
EAGLDLEMPGPTCWRKVEAVVEAVKTGKVSEKAINDRARNVLEFLVRLGCFEDPTIPEEK
AINRPEHQRLIRSVGSQGLVLLKNDGVLPLKKEQLAKKKVALLGFAREALIHGGGSASVN
AHYRITSEEGLRAALGDDVEFEFAKGAHTFRQLPLMAAEVVNRDGKPGWTLDFFTNEELK
GEPASSTAVESPTYVPLFIKDAWGSIKATASFTPSQTGQHYLAMSGLGRSKLTIDGEVIY
EQKENCPDSMAFLLGGVKEPEVRYAFEAGKTYSIEVITTKPIILGGVAMFDGHLGFRLGF
MTAQDHNRDLLSQAVEVAKGCDVAIVFTGHAPDWETEGQDQVSFHLPSDGSQDRLVAAVG
AVNPNTIVVNCTGVAVAMPWLDDVKAVVQAWFPGQEAGNAIADVLTGAVNPSGRLPVSFP
RRLEDAPAYGNFPGEYIENGKGKHLHVKYEEGVFVGYRHYDRSEETRSTVLFPFGYGLSY
TTFAHANHQASIHEATDDTSLAVTVDVTNTGPRAGAEVVQVYAGAKAVSAENPVKELIGF
AKVHLEPGETKSVSIHADSRQLAHFSEKSGKWELPQGSYEVSIGQSVRDITGKATVALGA
RSYDP

Enzyme Prediction     

EC	3.2.1.21:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	37	249	7.1e-66	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	2.45e-81	68	824	120	751	beta-glucosidase BglX.
224389	BglX	1.16e-67	29	383	47	395	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	4.21e-52	533	697	65	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	6.19e-47	12	831	55	776	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	1.29e-46	53	283	76	315	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA65189.1|GH3|3.2.1.21	0.0	6	845	7	845
ABF50843.1|GH3|3.2.1.21	0.0	6	845	7	845
BCS18431.1|GH3	0.0	4	845	5	845
UPK99435.1|GH3	0.0	7	844	3	833
CEF72767.1|GH3	0.0	7	845	3	834

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	4.39e-182	10	830	6	828	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	1.19e-178	10	830	6	828	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	4.97e-134	8	840	3	670	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	7.37e-116	17	838	12	663	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	1.82e-115	9	845	3	721	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BFG8|BGLB_EMENI	0.0	6	845	7	845	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|P27034|BGLS_RHIRD	6.06e-205	10	838	2	810	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
sp|A1CA51|BGLI_ASPCL	2.24e-195	10	823	6	815	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|A1DFA8|BGLI_NEOFI	4.99e-194	8	823	4	815	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1
sp|Q5BB53|BGLI_EMENI	5.14e-194	8	823	4	816	Probable beta-glucosidase I OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglI PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000043	0.000000

TMHMM  Annotations     

There is no transmembrane helices in P175DRAFT_0454317-t39_1-p1.