CAZyme Information: P175DRAFT_0439084-t39_1-p1

Basic Information

• Species: Aspergillus ochraceoroseus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus ochraceoroseus
• CAZyme ID: P175DRAFT_0439084-t39_1-p1
• CAZy Family: CBM87|CE18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
567	MSFN02000005|CGC10	62593.78	5.2665

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AochraceoroseusIBT24754	9070	1392256	153	8917

• Gene Location: location=MSFN02000005:2175100-2176934(+)

Full Sequence      

MSSSISWDFIVVGSGPAGCAIASRLARSAARPQVLLLEAGNRRDEKALRVDGKRWMSFRQ
SDTNWGYKTIPQEHCNDREIDFSRGKVLGGSSAINFGVYTVGAQDDYDEWAALVEDDAFR
WEKIQERFKSLETFHRGVPDPRYAHLADPKESDHGKDGALRLGYAGEWEPDLPLVLEALN
EAGLPLNLDHNSGNPIGMAVGINSAYSGVRTTAADLLRDAPENLTIIPASPVQRVILDGK
IAVGVESNGLQYLASKDVIISAGSLDSPKILMHSGIGPADQLEKFNIPVVKDIRAIGHGM
RDHPFVPLCFLRNPETNDRNSFFGKQEAMDAAMEQWMIDGTGPWARYASQILMGWFKSDR
ITQSAEFKALPASTQEFLNRPTVPHYELASHFPIHMLVPELTQDYSYVCFAFFLMNQQSK
GEVRLQSSDPNEPLLFNANFLAHPYDRRVCIEAARELLRVTNHEAFKKDTVSMILGPASE
SDEDILEFCKNLVGSAWHMTGTVKMGKPGQADAAVDSKFRVCGVENLRVADMSVVPVMTN
NHTQATAYVTGASCADILIAEYGLDRA

Enzyme Prediction     

No EC number prediction in P175DRAFT_0439084-t39_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	6	559	1.9e-147	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	3.36e-86	6	561	7	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	1.17e-75	8	557	7	530	choline dehydrogenase; Validated
215420	PLN02785	2.10e-39	6	551	55	569	Protein HOTHEAD
398739	GMC_oxred_C	9.52e-34	418	552	2	141	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	2.09e-23	75	304	14	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA62931.1|AA3_2	8.37e-286	1	565	1	569
CAK46531.1|AA3_2	1.01e-283	2	565	3	566
BCR99292.1|AA3_2	1.43e-283	2	565	3	566
BCS11595.1|AA3_2	1.43e-283	2	565	3	566
UPL00845.1|AA3_2	1.73e-249	4	564	3	564

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4H7U_A	5.52e-58	1	561	35	599	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
3Q9T_A	4.14e-52	7	562	7	573	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	5.72e-52	7	562	7	573	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5ZU2_A	7.90e-52	7	562	7	573	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
3FIM_B	9.07e-52	7	561	3	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0R4L2|PDH3_LEUMG	2.85e-61	1	561	35	597	Pyranose dehydrogenase 3 OS=Leucoagaricus meleagris OX=201219 GN=pdh3 PE=2 SV=1
sp|Q0CJ60|ATC_ASPTN	7.06e-60	1	561	40	596	Cyclase atC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=atC PE=1 SV=1
sp|Q5B8A1|PKFF_EMENI	1.79e-59	6	558	40	607	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1
sp|V5NC32|PDH1_AGAXA	5.43e-59	1	560	35	596	Pyranose dehydrogenase OS=Agaricus xanthodermus OX=83518 GN=pdh1 PE=1 SV=1
sp|V5NDL4|PDH1_AGACM	9.53e-59	5	561	35	592	Pyranose dehydrogenase OS=Agaricus campestris OX=56157 GN=pdh1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000049	0.000006

TMHMM  Annotations     

There is no transmembrane helices in P175DRAFT_0439084-t39_1-p1.