CAZyme Information: P175DRAFT_0437936-t39_1-p1

Basic Information

• Species: Aspergillus ochraceoroseus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus ochraceoroseus
• CAZyme ID: P175DRAFT_0437936-t39_1-p1
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
623		68200.83	4.6775

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AochraceoroseusIBT24754	9070	1392256	153	8917

• Gene Location: location=MSFN02000004:2021570-2023726(-)

Full Sequence      

MDKRSALLVLAGLVLTSAVAVPRHAKLVSEIEVETQRYDFIIAGGGVAGLTVADRLTEVR
DAVNVLVIEAGPVDLGQDFIYVPGAYNRTLYSWPNLISEPEEELNDQVFPAVCARVTGGG
STINAMIFLRGAAADYDGWESLGNGGWGWEDMLPYFIKSENFTYPTTELAHEGNITWDDS
VRGHHGPVQYSYPNYIYPGLGAWYEAARHIGMQPRLDPNAGANTGVFNPPFALNATTWTR
SSAKRNHYDRGVTRPNYHFLANTTVARVIFDGTQATGVEYLPTAGGRISRVFASREVLVA
AGALHTPQILQLSGVGPRNLLNSLDIPVVSDLPGVGSNLQDQTTFPVQYTWAHSITPNVT
TFLTNATWAAEQLVLYDHHLPSVWSVTRYLAPKFGFMSYDDVTSGTPYEQILANAEARDP
ADSLPPGVDPTILAGYTAQRELMFDEFRQPEMGIGSLGWDTDTSVQIFSVKPFSRGSVHI
NQTDPLANPLINFRTATDPTDFEILTALFRKQRELFEAPSIAALGPTERVPGPSVQTDDE
VVATMRDILQPSNAHECCTAPMMPRELGGVLSPEMKVYGTSRLRVIDISYWPKALSGPPM
ATMYASGEKVADMIKAEYGWSTE

Enzyme Prediction     

No EC number prediction in P175DRAFT_0437936-t39_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	37	616	1.8e-164	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	1.16e-91	38	617	8	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	2.68e-88	35	615	3	532	choline dehydrogenase; Validated
398739	GMC_oxred_C	5.84e-34	472	609	1	142	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	6.11e-30	105	344	15	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	3.32e-14	38	341	56	326	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS25132.1|AA3_2	0.0	1	620	1	619
EAA58801.1|AA3_2	0.0	1	620	1	619
AEO67797.1|AA3_2	2.51e-231	18	618	26	636
CDP29496.1|AA3_2	7.95e-213	22	619	31	642
VBB81292.1|AA3_2	7.95e-213	22	619	31	642

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZE2_A	1.04e-229	38	618	6	586	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
6O9N_A	1.14e-102	15	618	14	642	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]
4YNT_A	1.02e-65	35	617	3	567	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
6XUT_A	8.01e-65	33	616	12	589	Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUU_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUV_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina]
5NCC_A	3.33e-54	17	621	1	585	Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AUN2|XPTC_EMENI	0.0	1	620	1	619	Dehydrogenase xptC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xptC PE=3 SV=1
sp|Q5GMY3|GMCH_MALSM	9.04e-74	32	614	41	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|M5EAX2|GMCH_MALS4	9.04e-74	32	614	41	615	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	3.78e-68	39	617	41	632	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|B9JBA2|BETA_AGRRK	8.91e-63	39	614	4	525	Oxygen-dependent choline dehydrogenase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) OX=311403 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000391	0.999570	CS pos: 20-21. Pr: 0.9744

TMHMM  Annotations     

There is no transmembrane helices in P175DRAFT_0437936-t39_1-p1.