CAZyme Information: P175DRAFT_0433833-t39_1-p1

Basic Information

• Species: Aspergillus ochraceoroseus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus ochraceoroseus
• CAZyme ID: P175DRAFT_0433833-t39_1-p1
• CAZy Family: AA7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
908		101670.22	5.5203

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AochraceoroseusIBT24754	9070	1392256	153	8917

• Gene Location: location=MSFN02000002:153430-156156(+)

Full Sequence      

MTEENPHLTPPSFEQHPTGFGIEVAAPRISWRFLSSPSTTQNWEQSAYDVELIHLPGSKV
ETYHISSGNSVLVPWPSRPLLSRERARVRVRAYGRTKTSEHTKDSGETDWSPWAMVECAL
LNRSDWIGRPITIAEEREVNGPQRPLRFRKTFTIPLTEGISKARLYMTSLGSYTAYINGR
RVGDECLAPGWTSYHHRINYQVFDIATLVEPARVNVIAVEVGEGWYATRLGFLGGKRCIW
GKDLAVLAQIEMVSEDGEEFRLVSNDSWKCKLSAIIRSELYDGELYDAREEEEGWNGGEA
FDDSSWLRTRSLALPSAQLVIPDAPPVRVIEVIKPVEIFTTPLGKTVIDFGQNMVGKLCI
HHLKKPSGTKLTFAHAEVMETGELGVRPLRDAKCTDQIITSDEDLVDWSPKYTYHGFRYV
QVDGWSTADKICPLTTLSVSALVMHTDMVRSGHFSCSHPMVNKLHENAVWSMRGNFFSVP
TDCPQRDERLGWTGDIQIFCPSANFLYNTAGILGDWLKDVALEHLSLEHAIPPLVIPNAL
EDRWDGDPHAVWDDATVLTPWALYQSYGDVEILRRQYQSMITWVDRGIPRGPDGLWNIER
WQLGDWLDPTAPPDQPGNSRTNATLVADAYLIRVTLIIAQVSEILHEESNATRYHDDYLR
LKAIFQQKYIAPSGLIIGDSQTALSLALMFALYDTDKQKATAGERLAYLVRLAAFRVSTG
FVGTPIITHALTSAGYSQLAYRMLLEKGCPSWLYPITMGATTVWERWDSMTPDGSINSGE
MTSFNHYALGSVINWLHTTVAGISPIDPGWKKIRVQPIPGGTITSARATYETSYGRVECA
WKVQDNDIFVLDLAVPPNSSALVILPGRDEEQWVGSGRHSFCGGYAPGPWPPEPIRDFLG
QPSVEFIA

Enzyme Prediction     

EC	3.2.1.40:1	3.2.1.40:8	3.1.1.73:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	338	865	1.4e-158	0.998015873015873
CBM67	134	313	1.1e-34	0.8977272727272727

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407469	Bac_rhamnosid6H	1.19e-151	450	800	2	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
400715	Bac_rhamnosid_N	3.74e-64	160	331	3	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
336149	Bac_rhamnosid	8.96e-29	340	445	2	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
379972	Bac_rhamnosid_C	2.93e-25	802	880	1	78	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK38995.1|GH78	0.0	11	908	10	923
QRD82895.1|GH78	0.0	8	908	7	923
BCS09327.1|GH78	0.0	11	908	10	922
QMW28401.1|GH78	0.0	8	908	7	923
BCR96839.1|GH78	0.0	11	908	10	922

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GSZ_A	4.17e-273	12	881	8	863	Crystal structure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
3W5M_A	1.71e-155	21	872	188	1001	Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6I60_A	5.48e-127	21	877	45	910	Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q82PP4|RHA78_STRAW	6.38e-155	21	872	188	1001	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
sp|T2KNB2|PLH20_FORAG	1.34e-144	1	871	31	884	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
sp|P9WF03|RHA78_ALTSL	4.39e-126	21	868	45	881	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
sp|T2KPL4|PLH28_FORAG	1.10e-69	22	878	46	919	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000062	0.000000

TMHMM  Annotations     

There is no transmembrane helices in P175DRAFT_0433833-t39_1-p1.