CAZyme Information: P175DRAFT_0432516-t39_1-p1

Basic Information

• Species: Aspergillus ochraceoroseus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus ochraceoroseus
• CAZyme ID: P175DRAFT_0432516-t39_1-p1
• CAZy Family: AA7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
610		66837.24	4.7579

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AochraceoroseusIBT24754	9070	1392256	153	8917

• Gene Location: location=MSFN02000002:4245580-4247613(+)

Full Sequence      

MLNGWSLLALTGVPLLGIFASQSSTFSSPWRAIFDSEDKGAMDGRIQARDLLSSHFGMYG
WPGQSFDYVIVGGGTAGLALAHRLSEDGSNSVAVVEAGGFHEIEAGNATDVPMYLFNYFF
DNGHVKNPLFDWYQYTEAQPVRSKGAYQMWADQVGDDAYTWDNWLPFFKKSVHFSGPATN
PRPTNATTLNDFSVFASSASEGGPVQVAYPYWTNAISSWVDKALQKMGFPEVQGFSNGEL
LGRSYITHTINPKTRRRDTASTSYLRAALLKSDNLNIITHTLVKKILFNEEKRATGVVID
TGGFEWQIGAKKEVILSAGVMRSPQLLMVSGIGPKATLEKLDIPVLSDLEGVGKNMQDTI
ILGPTNPVKVESHSQLMGSKETLPRSIFEYNTFRTGLLTNPGQDYFAFEKHQPGSLSAKT
ATDIEKAFPADWPTFSYIALDDTFVPQYDGKNYFSMSAALMTTFSRGTVTINTTNTANNP
VVDPRWLDDPRDKEMAVAAFRRCREIVASETMQEVIDGTELLPGFQYQTDEEILNYIAET
SDAYYAGVGTCAMGKPDDPKTVIDSKAQVLGVQGLRVVDASSFPFAIDGQPMGTVYALAE
KIAADILTGN

Enzyme Prediction     

No EC number prediction in P175DRAFT_0432516-t39_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	143	607	6e-133	0.823943661971831

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	1.13e-79	64	607	4	532	choline dehydrogenase; Validated
225186	BetA	8.83e-73	65	607	7	534	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	1.38e-33	480	602	18	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	4.69e-24	53	607	43	577	Protein HOTHEAD
366272	GMC_oxred_N	1.34e-16	147	358	46	215	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA61600.1|AA3_2	0.0	5	610	4	616
BCS19620.1|AA3_2	0.0	5	610	4	639
QFQ50482.1|AA3_2	0.0	5	610	4	633
VBB75829.1|AA3_2	0.0	7	610	8	645
CDP25743.1|AA3_2	0.0	7	610	8	645

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZE2_A	4.31e-51	64	603	4	579	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
2JBV_A	2.19e-48	64	603	12	523	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]
3NNE_A	2.19e-48	64	603	12	523	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]
3LJP_A	3.01e-48	64	603	12	523	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]
6YS2_AAA	6.43e-44	63	610	5	563	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A4UHS8|VBSA_DOTSE	0.0	6	610	5	647	Versicolorin B synthase OS=Dothistroma septosporum OX=64363 GN=vbsA PE=2 SV=2
sp|Q12062|AFLK_ASPPU	0.0	3	610	4	643	Versicolorin B synthase OS=Aspergillus parasiticus (strain ATCC 56775 / NRRL 5862 / SRRC 143 / SU-1) OX=1403190 GN=aflK PE=1 SV=1
sp|C8VDT4|STCN_EMENI	0.0	5	610	4	639	Versicolorin B synthase stcN OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=stcN PE=2 SV=1
sp|M2Y151|VBSA_DOTSN	0.0	6	610	5	647	Versicolorin B synthase OS=Dothistroma septosporum (strain NZE10 / CBS 128990) OX=675120 GN=vbsA PE=2 SV=1
sp|A1CFL2|PATE_ASPCL	7.27e-137	44	606	31	624	Patulin synthase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=patE PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.335270	0.664712	CS pos: 20-21. Pr: 0.6338

TMHMM  Annotations     

There is no transmembrane helices in P175DRAFT_0432516-t39_1-p1.