CAZyme Information: P175DRAFT_0411436-t39_1-p1

Basic Information

• Species: Aspergillus ochraceoroseus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus ochraceoroseus
• CAZyme ID: P175DRAFT_0411436-t39_1-p1
• CAZy Family: AA3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
447	MSFN02000008|CGC7	49115.08	8.7482

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AochraceoroseusIBT24754	9070	1392256	153	8917

• Gene Location: location=MSFN02000008:977053-978530(+)

Full Sequence      

RPIRSLSIAFGVWKAILFVIIACCPGLGYDTSSSHLPFPSTSALDVLISSGDPSHASLPI
PLKFVRWDSIYFVHIAQAGYVFEQEWAFSYVYGKLVDRLTSDASSGVASLAVTAVVLAHL
THFLSVLALYKLSINVFGNDSVQKQQLLCFLSAALHIVSPAGAFLSSLNAESLFSFLHIT
GFYIYSSSRRDHHVGKHVASYAKLVVSGILFAVATTVRSNGILSGILLAYDAVLLLHRIV
SQRSLGEPTVHLCFVVLSGCILALGLIIPQTLAYISYCTTEDVSRPWCQFLVPSIYSWVQ
SHYWDVGFFRYWTLSNLPLFLLSTPMLLILFLSCFWARGATVSSSSPKTSQANSDSASGP
ASTLLTQLAITQFLLAVLALTSYHVQIINRISSGYPLWYWYIASQLLDTRSLQSTLKSRS
YFSRVVQLMVVYALVQATLYGSFLPPA

Enzyme Prediction     

No EC number prediction in P175DRAFT_0411436-t39_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	10	447	2e-108	0.9877149877149877

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	3.45e-35	65	447	58	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	1.38e-21	66	447	76	408	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS24525.1|GT76	2.34e-181	1	447	22	473
CAK38795.1|GT76	3.31e-162	1	447	20	466
BCS01167.1|GT76	5.19e-162	1	447	20	469
BCS12914.1|GT76	5.19e-162	1	447	20	469
QMW40534.1|GT76	5.81e-152	1	447	17	452

PDB Hits     

P175DRAFT_0411436-t39_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2UJS7|GPI18_ASPOR	1.58e-147	1	447	17	434	GPI mannosyltransferase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi18 PE=3 SV=1
sp|Q4WQ21|GPI18_ASPFU	2.09e-139	1	447	28	441	GPI mannosyltransferase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi18 PE=3 SV=1
sp|Q4I0K3|GPI18_GIBZE	6.49e-75	1	447	9	423	GPI mannosyltransferase 2 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI18 PE=3 SV=1
sp|Q2GSI6|GPI18_CHAGB	1.18e-74	1	447	17	471	GPI mannosyltransferase 2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) OX=306901 GN=GPI18 PE=3 SV=1
sp|Q6C216|GPI18_YARLI	3.41e-39	1	447	2	357	GPI mannosyltransferase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=GPI18 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.097611	0.902366	CS pos: 22-23. Pr: 0.4034

TMHMM  Annotations     

Start	End
7	29
105	127
147	169
197	214
221	240
255	277
317	339
363	385
422	444