CAZyme Information: P175DRAFT_0264841-t39_1-p1

Basic Information

• Species: Aspergillus ochraceoroseus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus ochraceoroseus
• CAZyme ID: P175DRAFT_0264841-t39_1-p1
• CAZy Family: AA11
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
458		51541.58	4.7570

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AochraceoroseusIBT24754	9070	1392256	153	8917

• Gene Location: location=MSFN02000005:1157171-1158547(+)

Full Sequence      

MGLNSTWDDSARPNENVPPLNEKFPYGSQPIRGVNLGGWLSLEPFITPSLFEGYTNVIDE
YTLSKTLGSDAASTIEKHYATFITEQDFADIRDAGLDHVRIQFSYWAFAPIDGEPYVPKI
AWRYLLRAIEYCRKYGLRVNLDPHGIPGSQNGFNHSGRQGQIGWLNGTDGSANAQLALDL
HNQLSQFFSQERYKNIVAIYGLVNEPFMLSLDIEKVLNWTTEATELVQKNNITAWVAFHD
GFLNLSKWKSMLKSGPAGLLLDTHQYTIFNTAEIVLNHTAKVDLICNSWYSMISEINSTS
EGYFLPILFLIAYTNRKIRWGPTICGEFSMADTDCAQYLNNVGRGTRWEGTYSTSDSTAY
CPTADETDQPACSCSNANADVSAYSDNYKTFLQTYAEAQMSAFSTALGWFYWTWYTESAP
QWSYKTGWKNGFLPAKAYAPSFKCGDTIPSFGTLQENY

Enzyme Prediction     

EC	3.2.1.58:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	77	295	7.9e-77	0.7128712871287128

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	1.22e-41	25	434	12	382	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	3.97e-04	82	207	24	132	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS30123.1|GH5_9	9.10e-263	1	458	401	842
ABX90782.1|GH5_9	6.40e-260	1	458	108	549
BAE57108.1|GH5_9	1.06e-259	1	458	122	563
CAK45960.1|GH5_9	1.32e-259	1	458	390	830
BCS16426.1|GH5_9	4.81e-257	1	458	389	829

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EQP_A	8.13e-79	26	445	4	392	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
2PB1_A	2.70e-78	21	445	5	398	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]
1CZ1_A	6.36e-78	26	445	4	392	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
2PC8_A	7.55e-78	21	445	5	398	Chain A, Hypothetical protein XOG1 [Candida albicans]
2PBO_A	7.55e-78	21	445	5	398	Chain A, Hypothetical protein XOG1 [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WMP0|EXGD_ASPFU	1.83e-260	1	458	392	833	Probable glucan 1,3-beta-glucosidase D OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=exgD PE=3 SV=1
sp|B0Y7W2|EXGD_ASPFC	1.83e-260	1	458	392	833	Probable glucan 1,3-beta-glucosidase D OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgD PE=3 SV=1
sp|A2QX52|EXGD_ASPNC	2.34e-260	1	458	390	830	Probable glucan 1,3-beta-glucosidase D OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=exgD PE=3 SV=1
sp|A1DMX4|EXGD_NEOFI	3.08e-259	1	458	393	834	Probable glucan 1,3-beta-glucosidase D OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=exgD PE=3 SV=1
sp|Q0CHZ8|EXGD_ASPTN	4.66e-257	1	458	397	838	Probable glucan 1,3-beta-glucosidase D OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=exgD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000052	0.000000

TMHMM  Annotations     

There is no transmembrane helices in P175DRAFT_0264841-t39_1-p1.