CAZyme Information: P174DRAFT_516199-t37_1-p1

Basic Information

• Species: Aspergillus novofumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus novofumigatus
• CAZyme ID: P174DRAFT_516199-t37_1-p1
• CAZy Family: GT90
• CAZyme Description: UDP-Glycosyltransferase/glycogen phosphorylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
869	MSZS01000011|CGC4	93664.94	7.7502

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnovofumigatusIBT16806	11729	1392255	197	11532

• Gene Location: location=MSZS01000011:452071-454971(-)

Full Sequence      

MATNDNREVFELPAEPMVLPPSLPGAAIGKSGVSMNDDGRVSIDWDSRFVRGFSKLYSRP
FLGRPTTPPPDYSELAPQSADDTIEISGPPPVYPESVVEIEKSWKVKLNIVIQVVGSRGD
VQPFIALGNELQRYGHRVRLATHDVFESFVRDSGLEFYPIGGDPADLMAYMVKTPGLIPS
MESLQAGDIQRKRIMVREMLRGCWRSCIDPDMHTQVPFVADAIIANPPSFAHVHCAQALS
IPVHLMFTMPWSSTKAFPHPLANMSGGNADESLKNYVSYGVVDWLSWQGLGDVVNEWRRK
DLDLEDVAMFEGPHLAEILKVPFTYCWSPALVPKPLDWPSYIDVCGFFFRETPKYDPPAD
LQAFLASGPPPVYIGFGSIVLEDPERITTTIINAVNAVGARAIVSKGWSNLGGAHHDNIY
YIGDCPHEWLFNHVAAVVHHGGAGTTACGLRYSKPTLIVPFFGDQPFWGAMVAAAGAGPA
PIPHKQLTDDALAAGIRYCLSEQAAAAASTIAHKMSSESGVHAAVASFHRNLPLDRLQCD
LYPSQPAVWSVSVPKSRQKLKLSKFAAEALVADGLIDKKNLTIHPINPLLIENRRWDPIT
GGASAVMRTTTDLTGSLLGTFYKPIQEYQDYHKRRKDRRSSSISTQASHMPKSSSSVGST
STNIVKGKVAAGAGAGAGAASSNTKPPSDQGGGKLFARMAGASAKSLGSFVPTALKGIAV
DIPLALTEGLRNIPRFHGEEPRDNGPVTDIKSGFAVAGNGFVWGMAEAVSDIVVKPYQGM
QQDGAKGAVKGVGKGMSNMVSKAGCAMFGVLIYPSAGIAKSLHASIHSRTRKLIVKARRG
EGAWMLESGQYTDTDRDQVVTGFRGIIEG

Enzyme Prediction     

EC	2.4.1.173:23	2.4.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	134	529	2.1e-60	0.9633507853403142

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	3.47e-66	108	468	1	342	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	3.75e-32	110	468	4	335	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
397255	Glyco_transf_28	2.23e-25	110	258	1	139	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR86527.1|GT1	0.0	1	869	1	865
BCR84763.1|GT1	0.0	2	869	3	871
BCR98772.1|GT1	0.0	1	864	1	863
BCS11094.1|GT1	0.0	1	864	1	863
CAP93840.1|GT1	0.0	1	869	1	868

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XVM_A	1.17e-71	115	536	27	443	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C],5XVM_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C]
5GL5_A	1.95e-71	115	536	47	463	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C],5GL5_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C]
1IIR_A	2.11e-29	108	524	1	391	Crystal Structure of UDP-glucosyltransferase GtfB [Amycolatopsis orientalis]
3H4I_A	2.59e-28	108	511	1	365	Chimeric Glycosyltransferase for the generation of novel natural products [Amycolatopsis orientalis],3H4T_A Chimeric Glycosyltransferase for the generation of novel natural products - GtfAH1 in complex with UDP-2F-Glc [Amycolatopsis orientalis]
1RRV_A	1.64e-24	108	524	1	392	X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis],1RRV_B X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9XIG1|U80B1_ARATH	3.57e-129	67	533	123	575	Sterol 3-beta-glucosyltransferase UGT80B1 OS=Arabidopsis thaliana OX=3702 GN=UGT80B1 PE=1 SV=1
sp|Q9M8Z7|U80A2_ARATH	5.68e-127	95	533	180	611	Sterol 3-beta-glucosyltransferase UGT80A2 OS=Arabidopsis thaliana OX=3702 GN=UGT80A2 PE=1 SV=1
sp|Q4WID6|ATG26_ASPFU	1.24e-77	108	532	902	1319	Sterol 3-beta-glucosyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=atg26 PE=3 SV=2
sp|A1CYS1|ATG26_NEOFI	1.29e-77	108	532	911	1328	Sterol 3-beta-glucosyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=atg26 PE=3 SV=1
sp|A1CFB3|ATG26_ASPCL	5.60e-77	85	532	884	1325	Sterol 3-beta-glucosyltransferase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=atg26 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000065	0.000000

TMHMM  Annotations     

There is no transmembrane helices in P174DRAFT_516199-t37_1-p1.