CAZyme Information: P174DRAFT_516177-t37_1-p1

Basic Information

• Species: Aspergillus novofumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus novofumigatus
• CAZyme ID: P174DRAFT_516177-t37_1-p1
• CAZy Family: GT8
• CAZyme Description: putative cell wall glycosyl hydrolase Dfg5

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
432		47873.37	4.4570

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnovofumigatusIBT16806	11729	1392255	197	11532

• Gene Location: location=MSZS01000011:349870-351244(+)

Full Sequence      

MITRINHNAFHAITMAPHPLDLNDPTSIKQAAHDVAANMLSHYTGMKPGDNPGNLPPPYY
WWEAGAMFNALIDYWYLTGDSTWNAITTQALTWQAGHTGTFMPTNQTKTEGNDDQAFWGF
AAMSAAERNFPDPDPAHGPGWLAMAQAVFNTQAARWDESTCGGGLRWQIFSFNNGWNYKN
TISNGCFFNLAARLARYTGNSTYAEWAERIWDWTVDVGFITDDWLFYDGADVLLDCSDFN
RIEWTYNSGVYLLGAANMYNFTEADPRWEARTKHILEATDAFFVKDPAMVMYERACELVN
TCQVDQRSFKGFLARWMAAATQVAPFTYDWVMPRLRASAAAAARTCTGGPDGAACGLKWT
TGVWDGSEDVGLQMSALEVMQNLLIDRVDPPVTDATGGTSIGDPSGGMEQHDPRPQVLTM
TITGADRAGRDS

Enzyme Prediction     

EC	3.2.1.101:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	26	390	7.8e-115	0.9497206703910615

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	0.0	27	377	1	348	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
227170	COG4833	1.22e-07	162	258	133	221	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMS79050.1|GH76	2.73e-227	20	429	20	425
CAK47214.1|GH76	9.97e-224	1	429	1	429
BCS10548.1|GH76	2.85e-223	1	429	1	429
BCR98100.1|GH76	2.85e-223	1	429	1	429
QMW28732.1|GH76	4.24e-217	20	429	20	425

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	6.65e-114	28	408	36	426	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]
3K7X_A	2.19e-06	141	263	113	230	Chain A, Lin0763 protein [Listeria innocua]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q75DG6|DCW1_ASHGO	2.83e-130	20	429	24	430	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=DCW1 PE=3 SV=2
sp|Q5AD78|DCW1_CANAL	4.71e-129	20	429	21	431	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DCW1 PE=1 SV=1
sp|P36091|DCW1_YEAST	1.21e-128	20	429	24	428	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
sp|Q05031|DFG5_YEAST	6.52e-128	10	429	17	437	Mannan endo-1,6-alpha-mannosidase DFG5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DFG5 PE=1 SV=1
sp|Q6FLP9|DCW1_CANGA	7.14e-127	20	429	21	425	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999924	0.000116

TMHMM  Annotations     

There is no transmembrane helices in P174DRAFT_516177-t37_1-p1.