CAZyme Information: P174DRAFT_515877-t37_1-p1

Basic Information

• Species: Aspergillus novofumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus novofumigatus
• CAZyme ID: P174DRAFT_515877-t37_1-p1
• CAZy Family: GT76
• CAZyme Description: family 88 putative glycosyl hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
505	MSZS01000009|CGC6	55777.55	6.6864

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnovofumigatusIBT16806	11729	1392255	197	11532

• Gene Location: location=MSZS01000009:1089879-1091639(+)

Full Sequence      

MSKTGLGSHGDPPEPTTELRGPRLPTPGQLLGPACPDGLMKILYPLSCLLSLVLADRPGQ
AVRHPKHSTWMLESVIARGEGINPADGLLGVIQKVQHCRGMVGLFQEALRAAIAQSSDAA
EIARWSDYHRRSVEANIEDLLNATASSRDLSLDRLCVGRSIMEMNLDEPLHRNVLKALRK
SLELQYRNENAGFCDGMYGFAPFAALYGMTYGDPRLNVDSALLQLDLLYKQSIEPSTGLI
KHGYDASREAPWAHPITGASPIVWGRSLAWYLIGTVDTLEIIASKYEDNANAMRKDKTVQ
RILEIFQRLARATVETIEDSAGKTGRYAVWQVMDRPGEPGNFVEASASAMIAYVLAKGVR
LGHLPGSGRSPTLEAVGKHRASSYLRVQGPMPGFRDPVRSQDVLAVARALYQDVVEQFVV
RRQEDDTLDFLGTSIIASLHEEKPYYEVRFVPFSRSYVFWLMTISAVLYSPSSHNEQLDW
DQCVCPSLPRDGASGHLRGVDNSVY

Enzyme Prediction     

No EC number prediction in P174DRAFT_515877-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	112	371	2.5e-37	0.75

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226678	YesR	2.07e-30	187	375	127	296	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
400034	Glyco_hydro_88	9.04e-24	148	365	68	274	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAE47860.1|GH105	2.08e-271	3	459	7	508
QDS73972.1|GH105	2.65e-52	75	445	1	325
BCS25093.1|GH105	1.78e-48	48	445	14	380
QRC92053.1|GH105	1.91e-47	40	366	1	319
USW52706.1|GH105	1.11e-46	71	449	1	357

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	1.55e-27	149	375	71	294	Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	8.94e-19	124	375	61	307	Structure of Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	3.56e-18	124	375	51	297	Chain A, Putative glycosyl hydrolase yteR [Bacillus subtilis]
4XUV_A	7.03e-06	186	376	140	317	Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P0A3U6|PIC1_AGRFC	2.51e-22	202	388	4	170	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
sp|P0A3U7|PIC1_RHIRD	2.51e-22	202	388	4	170	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1
sp|O34559|URHG2_BACSU	4.60e-18	124	375	61	307	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.853527	0.146461

TMHMM  Annotations     

There is no transmembrane helices in P174DRAFT_515877-t37_1-p1.