CAZyme Information: P174DRAFT_515831-t37_1-p1

Basic Information

• Species: Aspergillus novofumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus novofumigatus
• CAZyme ID: P174DRAFT_515831-t37_1-p1
• CAZy Family: GT76
• CAZyme Description: bacterial alpha-L-rhamnosidase domain protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
649	MSZS01000009|CGC5	70520.20	6.3896

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnovofumigatusIBT16806	11729	1392255	197	11532

• Gene Location: location=MSZS01000009:872134-874167(-)

Full Sequence      

MRLLSFFVVAAAVCTAVPYEEYILAPATRDLVPERVYHVNGSISNPSALTNAKGGKATFH
GVSSVTYDFGRNIAGIVSLDVSRVSSQDAFIGVTFSESSLWINNEACDATADAGLDSPLW
FPVGQGSGRYTAETKHNRGAFRYLTLVTNTSATIVVESVRVNFTAAPSQNLRAYTGYFHC
NDELLNRIWYAGAYTNQLCTIDPSMGNALPLLGTITSSGNISLPETVPWWSNDTISNGTS
VLTDGAKRDRLVWPGDMSIALESIAVSTYDLYSVRMALDSLFAIQQADGRLPYAGKPFYD
IVSYTYHLHSLIGVSYYYRYSGDLNWLAAHWNQYKRALQWSLSSIDDTGLANVTASADWL
RFGMGGHNIEANSILYFVLQESLLLAKTLNDTTTSSSSTWSRIATTLKSSANARLWDPAV
GLYRDNETTTLHPQDGNAWALKANLTLSANQSSIISAALSARWGPYGAPAPEAGATISPF
ITGFELQAHFLADQPQRALDLMRRQWGFMLDDPRMTQSTFIEGYSTDGSLHYAPYRNDAR
ISHAHGWATGPTAALMFYAAGLQLVGAGGERWVFAPMPGDLRRAEAGFETSLGGKKGYTK
LVFTTPEGTMGDVKLDAEGVLVSSSGTRVRLVEGVATGLHGGTWRLKSL

Enzyme Prediction     

EC	3.2.1.40:5

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	237	614	1.2e-62	0.7341269841269841

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407469	Bac_rhamnosid6H	6.12e-11	175	511	3	302	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
225942	GDB1	0.008	281	423	311	468	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UDD56671.1|GH78	0.0	11	647	16	659
QRD83147.1|GH78	0.0	11	647	16	659
QMW28625.1|GH78	0.0	11	647	16	659
BAE58354.1|GH78	0.0	11	647	16	659
QMW40695.1|GH78	0.0	11	647	16	659

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	1.76e-12	65	646	194	717	Crystal structure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

P174DRAFT_515831-t37_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000200	0.999776	CS pos: 16-17. Pr: 0.9828

TMHMM  Annotations     

There is no transmembrane helices in P174DRAFT_515831-t37_1-p1.