CAZyme Information: P174DRAFT_515825-t37_1-p1

Basic Information

• Species: Aspergillus novofumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus novofumigatus
• CAZyme ID: P174DRAFT_515825-t37_1-p1
• CAZy Family: GT71
• CAZyme Description: putative glycosyl hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
457	MSZS01000009|CGC6	50421.10	4.7408

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnovofumigatusIBT16806	11729	1392255	197	11532

• Gene Location: location=MSZS01000009:855689-857213(+)

Full Sequence      

MKLSSRTWTTLVTVVLAGQGAVTALELDINDVQSIKDAAATTAYNMMSNYTGNQTGQIPG
KLPDTWWEGGAMFMTLIQYWYWTGDTSYNEVTTQGMLFQKGNNDYFPSNYSNYLGNDDQV
FWGLAAMTAAELNYPEEDGQPSWVSLAQGVFNTQVPRWDTSTCHGGLRWQISTYQEGYRT
KNAISNGGLFQLAARLARYTNNETYSQWAERIWDWSATTPLLKESDWTIADTTTPDTECT
DHGDLQWTYNYGTYVSGAAYMYNYTNGGDKWKKGLDGLLGTTFKRFFPFQNGMVMSEIAC
EPNMKCDRNQDCFKGFLSSWLTFITTIAPYTSSEIVPRIQQSALAAAKQCSGGANQTLCG
RRWHQDTFDGTSSLEGQMSALSVFSSSMIAHKMQAQAPLTADTGGTSKGNASAGTGTEQA
RPQPQPVTTGDRAGAGIVTVVFLSGWIAAVTWMVYGR

Enzyme Prediction     

No EC number prediction in P174DRAFT_515825-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	31	402	2.2e-105	0.9692737430167597

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	0.0	34	381	1	348	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR95806.1|GH76	3.42e-259	8	456	8	461
BCS08339.1|GH76	3.42e-259	8	456	8	461
CAK43770.1|GH76	1.84e-250	8	456	8	455
QMW25974.1|GH76	3.32e-244	13	456	12	456
QRD87981.1|GH76	3.32e-244	13	456	12	456

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	3.56e-97	29	432	30	443	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P36091|DCW1_YEAST	1.23e-107	24	455	21	449	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
sp|Q6FLP9|DCW1_CANGA	1.79e-106	25	455	19	446	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
sp|Q75DG6|DCW1_ASHGO	1.32e-101	25	454	22	450	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=DCW1 PE=3 SV=2
sp|O74556|YCZ2_SCHPO	4.01e-101	24	414	19	407	Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.02 PE=3 SV=1
sp|Q5AD78|DCW1_CANAL	1.21e-99	24	454	18	451	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DCW1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000209	0.999767	CS pos: 24-25. Pr: 0.9689

TMHMM  Annotations     

Start	End
434	456