CAZyme Information: P174DRAFT_513785-t37_1-p1

Basic Information

• Species: Aspergillus novofumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus novofumigatus
• CAZyme ID: P174DRAFT_513785-t37_1-p1
• CAZy Family: GT45
• CAZyme Description: pectin lyase-like protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
778	MSZS01000005|CGC7	82457.69	5.9561

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnovofumigatusIBT16806	11729	1392255	197	11532

• Gene Location: location=MSZS01000005:3081579-3084035(-)

Full Sequence      

MCRPLELTVRLSFLIHFMRGLLSLTALASTLVMASSAAVGARAPSCSGPVKSSPSTYWLV
EQDHTGNPRGYAPNAGGNYNYPVWRNVLDYGAKNDGSGDQTGSLQKAINDNGSGGSRESS
GVTRYPAQVYLPSGTYQLGSTLNLRVGTLIVGDPINPPVIKAAAGFNGNTLTSFMTLMKN
VVLDTTALRPDTRITALQWGVAQGAGLTNVKINMPNYSTGHIGIHVQAGSTIAITDVQIN
GGVVGIDNSNQQVNFKSIHFNGCTTAFKASGGHTALLQGATFENCGVGIDMTSNGLGSLV
LLDSTSVNSGTTIKFHDSSNDGGNRNSQILIENLTHDNGNPIAQDSNGNVKLASTSHVDT
WVWGNVTPGQYETGTSFSTSRPNVLLSGGKFFTKAQPTYAEYASDQIVNVKAVAGHTVKG
DGYTDDSASLNAILADNAANCKISYFPYGVYIVKDTLVIPPGSRIVGEAWSVISGAGNAF
KDARNPKAVVRIGNPGDVGVAEIQDMRFSVSEVLPGAKILEVNMAGSAPGDVGLWNTIVT
VGGTAETSISTSCTNQDTSQCMAAYMVMHLTKSSSAYIENFWGWTADHNLDGGSGYTVIS
TGRGVLVESTKGTWLTGTGSEHHWLYNYNFHNAQNVYAGLLQTESPYMQGSGATQTAPAP
WTADSAVGDPDFSWCAGGDQKCRTALATNVDGGKDVLLYNSAAWAFFDGEWYGDYGTQCS
GNCQTNMMRVSNNPENLVWYSINTRKTNVMVLDGQSNPTEYNHPGGWEAIIQAYRQFA

Enzyme Prediction     

No EC number prediction in P174DRAFT_513785-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH55	51	774	5.2e-226	0.9878378378378379

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
403800	Pectate_lyase_3	1.40e-48	84	290	1	213	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.
403800	Pectate_lyase_3	3.41e-05	419	478	10	73	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW41258.1|GH55	0.0	46	778	64	806
UDD58907.1|GH55	0.0	46	778	64	806
BAE58922.1|GH55	0.0	46	777	64	805
QRD85481.1|GH55	0.0	46	778	64	806
QMW29184.1|GH55	0.0	46	778	64	806

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5M5Z_A	4.85e-114	53	778	2	757	Chain A, Beta-1,3-glucanase [Thermochaetoides thermophila],5M60_A Chain A, Beta-1,3-glucanase [Thermochaetoides thermophila]
3EQN_A	2.14e-111	46	774	11	755	Chain A, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQN_B Chain B, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQO_A Chain A, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQO_B Chain B, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P53626|E13B_TRIHA	5.82e-151	21	767	1	750	Glucan endo-1,3-beta-glucosidase BGN13.1 OS=Trichoderma harzianum OX=5544 GN=bgn13.1 PE=1 SV=1
sp|P49426|EXG1_COCCA	4.03e-105	57	730	48	740	Glucan 1,3-beta-glucosidase OS=Cochliobolus carbonum OX=5017 GN=EXG1 PE=1 SV=1
sp|D4B0V1|E13B_ARTBC	8.88e-99	55	754	41	852	Probable glucan endo-1,3-beta-glucosidase ARB_02077 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_02077 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.316717	0.683259	CS pos: 40-41. Pr: 0.5450

TMHMM  Annotations     

There is no transmembrane helices in P174DRAFT_513785-t37_1-p1.