CAZyme Information: P174DRAFT_512164-t37_1-p1

Basic Information

• Species: Aspergillus novofumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus novofumigatus
• CAZyme ID: P174DRAFT_512164-t37_1-p1
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
413		45419.98	9.4754

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnovofumigatusIBT16806	11729	1392255	197	11532

• Gene Location: location=MSZS01000004:1226953-1228409(+)

Full Sequence      

MSWSFPISLDRPYKSLLTVFAFWKTLLLFLAVFSPGPGYDTSTTLRLDRNATNAVGDGPF
TASLRLVSTKLTRWDAIYFTEVASRGYIFEQEWAFGYGFTKLINFFASALQKTGAVDYAF
REHIAGIIIAHAAHGLSVLVLYYLGCAIFSGRQGRMLAFVAACLHIFSPAGLFLSAPYGE
KPQPVGASTGLKDALIPLAGILCGLATTVRSNGILNGLLFLEEAIRVLYSMTGGITFAKS
RRLLAVGIAGVCTGLGFVIPQYIAYRDFCVNYPYTHYEEPRIWCRRTLPSIYSFVQDHYW
NNGFLRYWTVSNIPLFALASPMLAIMTYSALWTLNVEAGRLTGGGCLLRSLAAPQLILAI
LTLAKHHGYSSVRLDKKEVGSQKQRSYASLAVTFMICYAAVQGVLFASFLPPA

Enzyme Prediction     

No EC number prediction in P174DRAFT_512164-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	17	413	1.9e-89	0.995085995085995

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	1.18e-26	14	331	2	318	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	1.12e-10	73	369	76	348	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD83592.1|GT76	2.63e-171	10	413	6	472
QMW32162.1|GT76	2.63e-171	10	413	6	472
UDD57107.1|GT76	2.63e-171	10	413	6	472
QMW44188.1|GT76	7.49e-171	10	413	6	472
BAE62404.1|GT76	9.13e-167	10	413	39	523

PDB Hits     

P174DRAFT_512164-t37_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2UJS7|GPI18_ASPOR	8.02e-83	10	413	16	434	GPI mannosyltransferase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi18 PE=3 SV=1
sp|Q2GSI6|GPI18_CHAGB	9.18e-78	11	413	17	471	GPI mannosyltransferase 2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) OX=306901 GN=GPI18 PE=3 SV=1
sp|Q4I0K3|GPI18_GIBZE	1.95e-77	10	413	8	423	GPI mannosyltransferase 2 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI18 PE=3 SV=1
sp|Q4WQ21|GPI18_ASPFU	1.26e-76	11	413	28	441	GPI mannosyltransferase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi18 PE=3 SV=1
sp|Q6C216|GPI18_YARLI	9.15e-37	11	329	2	279	GPI mannosyltransferase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=GPI18 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000017	0.000004

TMHMM  Annotations     

Start	End
13	35
127	149
156	178
198	220
243	265
310	332
387	409