CAZyme Information: P174DRAFT_510088-t37_1-p1

Basic Information

• Species: Aspergillus novofumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus novofumigatus
• CAZyme ID: P174DRAFT_510088-t37_1-p1
• CAZy Family: GT32
• CAZyme Description: putative beta-glucosidase I

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
829	MSZS01000002|CGC30	90847.49	5.7145

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnovofumigatusIBT16806	11729	1392255	197	11532

• Gene Location: location=MSZS01000002:1985851-1988542(+)

Full Sequence      

MVQLDVEKTIEELTLGEKVALTAGIDFWHTAPVPRLNIPSLRLSDGPNGVRGTRFFNGVP
AACFPCATALGATWDTELLYEVGRLMGEESIAKGTHVVLGPTINTQRSPLGGRGFESFAE
DGVLSGILAGHYCKGLQETGVAATLKHFVCNDQEHERLAVDSIVTMRAMREIYLLPFQLA
MRICKTACVMTAYNKINGTHVSENKLIITDILRKEWGWDGLVMSDWFGTYSTSDAINAGL
DLEMPGPTRWRGTALAHAVSSNKTFEFVMDERVRNVLNLHNFVEPLGIPENAPEKALNRP
EDQALLRRAAAESVVLMKNQDHILPLKKEKPILVIGPNAKTAAYCGGGSASLDAYYTVTP
FEGVSAQSQGEVKFSQGVYSYRELPLLGPLLKTDDGKKGFKFRVYNEPPSEPNRQLIDEL
HLESSSGFLMDYKHPKIKTFTFYVDMEGYFTPEEDGIYDFGVTVVGTGKLFVDDELVVDN
SKNQRQGTAMFGTATVEEKGSKELKAGQTYKVVLQFGTAPTSDLDMRGVVIFGPGGFRFG
AARRVSQEELISTAAQLASQASQVVIFAGPRPRPHGSPPGSDEMISRVLDANPNAVVVIQ
SGTPVTMPWAHKAKALLQAWFGGNECGNGIADVLYGAVNPAAKLPLSFPVRLQDNPSYLN
FRSECGRVLYGEDVYVGYRYYEKVDLAPLFPFGHGLSYTTFSRSDLSLATTPEKPQLEDG
EPITATLSVTNIGSVAGAEIVQLWVAPPPTGVNRPVRELKGFAKVFLQPGETKKVEIVVE
KKLATSWWDEQREKWASEKGTYEVLVTGTGDEVLKSSFEVGKTRYWLGL

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	32	245	1.7e-65	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	1.93e-77	64	819	120	763	beta-glucosidase BglX.
224389	BglX	1.47e-73	1	340	10	365	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	1.62e-43	35	279	63	316	Glycosyl hydrolase family 3 N terminal domain.
396478	Glyco_hydro_3_C	2.04e-38	314	698	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	1.14e-31	13	780	60	743	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AJA36818.1|GH3	0.0	1	829	1	838
BAE61980.1|GH3	0.0	1	829	1	839
QMW44618.1|GH3	0.0	1	829	1	839
QMW32588.1|GH3	0.0	1	829	1	839
QRD84089.1|GH3	0.0	1	829	1	839

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	1.45e-259	1	829	1	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	1.97e-254	3	829	3	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	1.08e-147	4	823	3	671	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.03e-107	9	806	8	648	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	1.87e-98	6	824	4	717	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CAF5|BGLI_ASPTN	0.0	1	829	1	839	Probable beta-glucosidase I OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglI PE=3 SV=1
sp|B0Y8M8|BGLJ_ASPFC	0.0	1	829	9	865	Probable beta-glucosidase J OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglJ PE=3 SV=2
sp|A1CA51|BGLI_ASPCL	0.0	1	829	1	838	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|Q5BB53|BGLI_EMENI	0.0	1	829	1	839	Probable beta-glucosidase I OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglI PE=2 SV=2
sp|Q4WLY1|BGLJ_ASPFU	0.0	1	829	9	865	Probable beta-glucosidase J OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglJ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.998334	0.001697

TMHMM  Annotations     

There is no transmembrane helices in P174DRAFT_510088-t37_1-p1.