CAZyme Information: P174DRAFT_507667-t37_1-p1

Basic Information

• Species: Aspergillus novofumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus novofumigatus
• CAZyme ID: P174DRAFT_507667-t37_1-p1
• CAZy Family: GT31
• CAZyme Description: putative GMC oxidoreductase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
576		64044.36	6.5312

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnovofumigatusIBT16806	11729	1392255	197	11532

• Gene Location: location=MSZS01000010:634056-636039(-)

Full Sequence      

MGSIGNTQDVYDYIICGGGTSGCVVAGRLAENPDIKILVIEAGQHNRDLENVHMAGGWSN
NFDSETDWNIITKPMPGVDNRQVKLSRGRFLGGCSGCNGTLCIRGAKQDYDDWGLEGWSG
EEFFAAMRKAETFHTKPWFKADEKSHGYSGPLHTEPHDLAPIANLLLDSFVSQGLPLHHD
MFSTGDIPHGCGHVPRTVYKGIRSTAADYITKEYHRNNVTIQTDTTVDRVVLEQGPDGLR
ATSVITQLADGTPRTFHARKEIIVSGGAYCSPAILMRSGIGAREELEQHGIPCQVDLPGV
GKNLMDHLIVFMFYETEKEGLTNDFHVYHDNNLAKTYQQWKEHKSGFLSTFPFGSFAFAR
IDDRLKDEPLWRDAPRQPGRDPMGLTPKQPNIEFFTTECYGGPKQYNQFPIDHKHAFSMI
AELFAPKSRGTVTLKSKDAKENPVVDCNYLSDPLDMLVLTEACRFGNEIVMNGAGTKDIV
KGSWPPNLKHHTYKTREEWIPYVKEHATTCYHASGTCAMGKDDNLMAVLDNKLRVKSVAG
LRVADCSVMPTLHGGHTQMPAYGIGERCADFIKETW

Enzyme Prediction     

No EC number prediction in P174DRAFT_507667-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	11	574	8.6e-162	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	8.27e-106	7	573	2	532	choline dehydrogenase; Validated
225186	BetA	1.05e-98	11	574	8	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	4.28e-36	426	568	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	1.34e-33	78	309	14	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	7.85e-24	3	548	48	552	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UDD65288.1|AA3_2	0.0	1	576	1	574
QMW48130.1|AA3_2	0.0	1	576	1	574
QMW36070.1|AA3_2	0.0	1	576	1	574
QRD92967.1|AA3_2	0.0	1	576	1	583
AFB81353.1|AA3_2	0.0	1	576	1	576

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3Q9T_A	3.69e-71	11	573	7	570	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	5.15e-71	11	573	7	570	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5ZU2_A	7.18e-71	11	573	7	570	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
3LJP_A	1.66e-61	11	573	14	527	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]
2JBV_A	2.31e-61	11	573	14	527	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q47944|SDH_GLUOY	3.51e-77	11	573	5	528	L-sorbose 1-dehydrogenase OS=Gluconobacter oxydans OX=442 PE=3 SV=1
sp|Q39A44|BETA_BURL3	5.25e-72	7	573	2	533	Oxygen-dependent choline dehydrogenase OS=Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383) OX=482957 GN=betA PE=3 SV=1
sp|B4EHJ2|BETA_BURCJ	1.03e-71	7	573	2	533	Oxygen-dependent choline dehydrogenase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) OX=216591 GN=betA PE=3 SV=1
sp|B2K8U4|BETA_YERPB	1.47e-71	11	573	3	532	Oxygen-dependent choline dehydrogenase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) OX=502801 GN=betA PE=3 SV=1
sp|Q66D54|BETA_YERPS	1.47e-71	11	573	3	532	Oxygen-dependent choline dehydrogenase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) OX=273123 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000045	0.000002

TMHMM  Annotations     

There is no transmembrane helices in P174DRAFT_507667-t37_1-p1.