CAZyme Information: P174DRAFT_506362-t37_1-p1

Basic Information

• Species: Aspergillus novofumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus novofumigatus
• CAZyme ID: P174DRAFT_506362-t37_1-p1
• CAZy Family: GT22
• CAZyme Description: putative pectate lyase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
363		37773.43	4.9148

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnovofumigatusIBT16806	11729	1392255	197	11532

• Gene Location: location=MSZS01000007:617569-618850(+)

Full Sequence      

MKYAALFTTVGALVSQAMAIGVQGTAEGFASSVTGGGSATPVYPSTTDELVSYLGDSEAR
VIVLTKTFDFTGTEGTTTATGCAPWGTASGCQVAINQNDWCTNYQSSAPSVSVTYDNAGS
LGITVNSNKSLIGQGTSGVIKGKGLRIVSGAKNIIIQNIAVTDINPKYVWGGDAITINQA
DLVWVDHVTTARIGRQHYVLGTEASNRITLSNNYIDGESDYSATCDNHHYWNIYLDGSSD
KRPRPKVQGNTYLHAVNNYWNDNSNHAFEIGDGAYVLAEGNLFSDVTAAVESSSFTGELF
GSASDSSTCKSYIGRNCVANSFSSSGTLSGSTADVLSKFKGETVASASAAGTSPASSAGQ
GHL

Enzyme Prediction     

EC	4.2.2.10:25

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	113	284	8.1e-75	0.983957219251337

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	7.74e-47	111	286	2	189	Amb_all domain.
226384	PelB	2.00e-13	123	288	97	278	Pectate lyase [Carbohydrate transport and metabolism].
366158	Pec_lyase_C	2.48e-11	123	283	30	211	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD92196.1|PL1_4	1.20e-211	1	363	1	375
BAE65949.1|PL1_4|4.2.2.10	1.20e-211	1	363	1	375
QMW48793.1|PL1_4	1.20e-211	1	363	1	375
QMW36737.1|PL1_4	1.20e-211	1	363	1	375
UDD66064.1|PL1_4	1.20e-211	1	363	1	375

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1IDK_A	1.30e-163	20	363	1	359	Pectin Lyase A [Aspergillus niger]
1IDJ_A	3.33e-159	20	363	1	359	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]
1QCX_A	1.56e-157	21	347	2	341	Pectin Lyase B [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B0YCL3|PELB_ASPFC	2.85e-240	1	363	1	375	Probable pectin lyase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pelB PE=3 SV=2
sp|Q2TXS4|PELD_ASPOR	2.13e-212	1	363	1	375	Pectin lyase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pel2 PE=1 SV=1
sp|B8NVB7|PELD_ASPFN	2.13e-212	1	363	1	375	Probable pectin lyase D OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pelD PE=3 SV=1
sp|A2RBL2|PELD_ASPNC	4.02e-184	1	363	1	373	Probable pectin lyase D OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pelD PE=3 SV=1
sp|P22864|PELD_ASPNG	5.71e-184	1	363	1	373	Pectin lyase D OS=Aspergillus niger OX=5061 GN=pelD PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000246	0.999703	CS pos: 19-20. Pr: 0.9800

TMHMM  Annotations     

There is no transmembrane helices in P174DRAFT_506362-t37_1-p1.