CAZyme Information: P174DRAFT_506236-t37_1-p1

Basic Information

• Species: Aspergillus novofumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus novofumigatus
• CAZyme ID: P174DRAFT_506236-t37_1-p1
• CAZy Family: GT22
• CAZyme Description: putative polygalacturonase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
451		48940.52	6.6682

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnovofumigatusIBT16806	11729	1392255	197	11532

• Gene Location: location=MSZS01000007:162555-164030(+)

Full Sequence      

MYLANILPWVLLPLAAIADGTTGQSHRRTCIVKAEGSESIDDTPAILEAFHTCGKGGRIV
FQNTTYHVNSVMNTSGLHNCDIDLYGTLLWGTNISYWLSHSLDVGYQNQSTAWVIGGKNI
RFNGHGYGTLNGNGQVWYDYVKSVSNYPRRPHALTVARASNSVFQGLRFLQSQMWTLSVI
HSNHILFDSVYVNSTTTNGNSAPNWKDNTDGADTIYSSHITFNNWTVVNGDDSISTKANS
TDILITNSVFYRGLGIAIGSIGQYKDVFETIERVRAENITYYGTLHSLYFKTWTGEQVNY
PPNGGGGGLGCNHPSPSPFLECSGLLLTNAVTIDASDISASNLHAYNLRGAPFTISQCTT
FARAPSNCTSSKFQIRDLRIEDVTGSSATDVVASFQCSAVKPCTDIQIQNVNLQLSNGTM
ADEYLCGNVQGTRGFNCTGKACEKPSATGGC

Enzyme Prediction     

No EC number prediction in P174DRAFT_506236-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	54	431	1.7e-55	0.9569230769230769

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395231	Glyco_hydro_28	1.85e-22	114	413	47	303	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
215120	PLN02188	2.19e-18	34	430	44	391	polygalacturonase/glycoside hydrolase family protein
215426	PLN02793	4.94e-18	126	432	149	412	Probable polygalacturonase
177865	PLN02218	7.36e-18	34	414	75	409	polygalacturonase ADPG
178580	PLN03003	6.32e-16	126	442	119	388	Probable polygalacturonase At3g15720

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK38178.1|GH28	8.59e-190	10	451	48	463
ABD61567.1|GH28	8.59e-190	10	451	48	463
QRD90865.1|GH28	3.87e-178	1	451	1	421
UDD60769.1|GH28	1.57e-177	1	451	1	421
BCS20082.1|GH28	3.69e-172	7	451	3	425

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C2L_A	3.27e-30	27	441	16	386	Crystal structure of endo-xylogalacturonan hydrolase from Aspergillus tubingensis [Aspergillus tubingensis]
1HG8_A	1.39e-09	114	266	65	222	Endopolygalacturonase from the phytopathogenic fungus Fusarium moniliforme [Fusarium verticillioides]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2QG68|RGXB_ASPNC	4.58e-191	10	451	14	429	Alpha-L-rhamnosidase rgxB OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rgxB PE=2 SV=2
sp|B8NJB0|RGXA_ASPFN	5.64e-66	28	437	29	435	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=rgxA PE=3 SV=2
sp|Q2UP32|RGXA_ASPOR	5.64e-66	28	437	29	435	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=rgxA PE=3 SV=1
sp|A2QBB4|RGXA_ASPNC	5.79e-66	24	430	26	430	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rgxA PE=2 SV=2
sp|Q2EQQ2|RGXA_ASPNG	8.12e-66	29	430	31	430	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus niger OX=5061 GN=rgxA PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000213	0.999771	CS pos: 23-24. Pr: 0.6701

TMHMM  Annotations     

There is no transmembrane helices in P174DRAFT_506236-t37_1-p1.