CAZyme Information: P174DRAFT_506153-t37_1-p1

Basic Information

• Species: Aspergillus novofumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus novofumigatus
• CAZyme ID: P174DRAFT_506153-t37_1-p1
• CAZy Family: GT22
• CAZyme Description: putative beta-N-acetylglucosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
854		93537.99	6.1321

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnovofumigatusIBT16806	11729	1392255	197	11532

• Gene Location: location=MSZS01000006:2483021-2485766(+)

Full Sequence      

MPPEDLQKKVGQLFAVGFHGIVPSPEIKALIHEYGIGGIVLFKRNIQNATQLQSLTLALQ
EEARLAGHEYPLFIGIDQENGLVTRMSPPIAAQLPGPMALGATHSPELSYQVGQVTGETL
RFFGINMNYAPVCDINSEPLNPVIGVRSPGDDPEFVGRFASAATQGLREQKIIPSVKHFP
GHGDTAVDSHYGLPVIQKTREQLERCELIPFRRAVAEDVEAVMTAHISLPAIGDGKLPAT
LSADVLSILRNEMQYDGMIITDCLEMDGIRATYGTEQGAVLALEAGSDSIMICHTFAVQV
ASIQKVCDAVKSGRISASRLDEAYRRVVKLKNNFLSWETALLSRNLDDLVTLNNKAATLA
KNAYSLSVTLVRSDPNVLPLSKSGHLVLLFPGERTPAGGAVDGEGLGMKGAYDVTEFGEI
FRAHNPTTVELHYGSAGLSTEQYKLVEAADAAVLITFNARESLFQREMGLKLPQHTRKLV
AVAACSPYDFLDDDNIKTYITTYEPTIEAFTAAANILFGAITPTGTLPVGSKNVALGSVH
VSPFEAASDLTELVEVWNTALPTYPLPADSLHRLLTQANGHHFVARLESKVIGFCVMYMT
TNRGTTCCQLAALAVHPSYQRQGVGTALIAEARTWLMKNYKPCSLSLGSSFPRFWPGIPT
DLGQEVQEFFVHRGFRLNPLIPRSVDLYQDIKEFQPPEKYVARAKERGFTFAPLQPEQYE
ECLAGQKKNFSYNPAWVDMYHKLNPNDHPSSIMTAFDSQGKQVGWTLMLAPSSPVLQQNW
ALPPLCGPKTGLIGCVGVDEEYRKAGVGLALLCHAIEDMKQRGGEGVFVDWVSLEGWYEQ
LGFKVWRSYRTGQM

Enzyme Prediction     

EC	3.2.1.52:8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	69	291	6.8e-60	0.9583333333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	1.20e-85	1	426	1	397	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	3.06e-82	6	330	2	316	Glycosyl hydrolase family 3 N terminal domain.
235417	PRK05337	8.95e-44	36	294	26	281	beta-hexosaminidase; Provisional
185053	PRK15098	8.73e-13	6	529	47	597	beta-glucosidase BglX.
404402	Acetyltransf_7	3.68e-11	579	676	2	82	Acetyltransferase (GNAT) domain. This domain catalyzes N-acetyltransferase reactions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR85716.1|GH3	0.0	1	852	1	852
QMW40223.1|GH3	0.0	1	854	1	863
QMW28153.1|GH3	0.0	1	854	1	863
CAP94355.1|GH3	0.0	5	854	5	852
BCR93582.1|GH3	0.0	1	854	1	857

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZM6_A	7.67e-162	4	852	7	856	A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]
6K5J_A	9.50e-100	6	528	13	528	Structure of a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	3.76e-68	24	534	74	620	Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	1.10e-67	24	534	48	594	Chain A, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	2.10e-67	24	534	78	624	Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P40406|NAGZ_BACSU	1.93e-67	24	534	74	620	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
sp|P48823|HEXA_PSEO7	6.96e-58	25	394	53	439	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
sp|Q0A911|NAGZ_ALKEH	8.90e-38	16	294	8	284	Beta-hexosaminidase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) OX=187272 GN=nagZ PE=3 SV=1
sp|Q87BR5|NAGZ_XYLFT	4.15e-37	13	294	1	279	Beta-hexosaminidase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) OX=183190 GN=nagZ PE=3 SV=1
sp|B2I6G9|NAGZ_XYLF2	4.15e-37	13	294	1	279	Beta-hexosaminidase OS=Xylella fastidiosa (strain M23) OX=405441 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000073	0.000000

TMHMM  Annotations     

There is no transmembrane helices in P174DRAFT_506153-t37_1-p1.