CAZyme Information: P174DRAFT_505430-t37_1-p1

Basic Information

• Species: Aspergillus novofumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus novofumigatus
• CAZyme ID: P174DRAFT_505430-t37_1-p1
• CAZy Family: GT20
• CAZyme Description: putative glycosyl hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
408		45513.09	4.5301

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnovofumigatusIBT16806	11729	1392255	197	11532

• Gene Location: location=MSZS01000005:3296364-3297703(+)

Full Sequence      

MMEFYDKNQTEGIPGKLTGTWYVAGAMFMTLIQYWHASSDDTYNPVVSHDLMFQSGENYD
FFSQNYSHWLGNDDQMFWGLASITASETGFPEIPDKPTWTSLARAVFNMQVARWDTTDCD
GGMRWQIPLYLPGYTMKNAISNGGLFELSARLARFTMNNTYAQWAEKIWDWSASTPLLQT
NHWYIADSTSIEANCKDAGNTQWSYNYGTYLSGASFMYNYTNGNEQWLERVNGLLNSLLG
TFCPNDKGGDVLSEVACEPIMTCDRNQIGFKGYTAMWLAHTAILVPSTATRIYPVLQGSA
LAISKQCSKQPGNTCGMRWWQSTWDGFTPGLESQMAALGGITANLMYFKSTAPKTIDTNP
DGKEHQIIATHEEETTLDTLPPIDVADRAGAWILTVIIVLTAGGRFGG

Enzyme Prediction     

No EC number prediction in P174DRAFT_505430-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	1	351	3e-93	0.9050279329608939

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	2.85e-171	1	338	13	348	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UDD65549.1|GH76	2.10e-221	1	407	1	406
QMW48345.1|GH76	1.12e-220	1	407	47	452
QRD92720.1|GH76	1.12e-220	1	407	47	452
QMW36289.1|GH76	1.12e-220	1	407	47	452
UDD65548.1|GH76	1.12e-220	1	407	47	452

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	2.97e-81	1	319	47	373	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AD78|DCW1_CANAL	5.30e-87	1	398	40	439	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DCW1 PE=1 SV=1
sp|O74556|YCZ2_SCHPO	1.12e-86	1	346	41	385	Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.02 PE=3 SV=1
sp|Q6FLP9|DCW1_CANGA	1.25e-86	1	398	40	433	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
sp|P36091|DCW1_YEAST	8.49e-85	1	398	43	436	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
sp|Q9P6I3|YHG7_SCHPO	2.41e-82	8	395	43	426	Putative mannan endo-1,6-alpha-mannosidase C1198.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1198.07c PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000015	0.000002

TMHMM  Annotations     

There is no transmembrane helices in P174DRAFT_505430-t37_1-p1.