CAZyme Information: P174DRAFT_502571-t37_1-p1

Basic Information

• Species: Aspergillus novofumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus novofumigatus
• CAZyme ID: P174DRAFT_502571-t37_1-p1
• CAZy Family: GT20
• CAZyme Description: glycosyl hydrolase family 3 N terminal domain-containing protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
788	MSZS01000003|CGC26	85476.85	5.4271

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnovofumigatusIBT16806	11729	1392255	197	11532

• Gene Location: location=MSZS01000003:1107972-1110455(+)

Full Sequence      

MLSLVSLSLLPLLTCALATPLSGNDTASHADNFRTWATASAMATDFVSRLNLTEKSAMLT
GKLSLGTGGCIGNILPINRIGYSGLCLQDGGNGVNLADLTTVFPSGVTVGASWDKKLMYE
RAVAMGEEFRSKGIHVALGPSAGPLGRHALGGRNWEGFSVDPYLSGIAIAATIEGIQSQG
VQACAKHIVGNEQETQRSFTISANGTRIEAISSNIDDRTMHELYIWPFANAIKAGVASAM
CSYNRLNQTYACENSALLNNILKVELGFQGYIMSDWFATHSGAKSINAGLDLNMPGAYSV
ETTATGESYWGANITTMVQAGSVSEERIDEMVRRIMIPYFFFGQDRDDYPPVDPSLAYSF
AAWSNVLDYLPKPIPNSRDVRGNHHRLVRKIGAESSVLLKNVDSTLPLKAPLNIGVFGND
AADPSDGLTFNERFEIGTLDIGAGAASVRHTYLVSPLEAIKARAKIFGGRVQHILRNSII
AAGDFSSLFPIPDVCLVFLNTFASENMDRQTYEADWNSTLVVENVARICPKTVVITHSAG
INSMPWANNVNVTAIIAAHLPGQESGNSIVDVLWGDVNPSGKLPYSIAKNPEDYDIPIVN
LTEAQGNSPTGWQSDFVEGQMIDYRQLDFAGIEPLFEFGFGLSYTTFSMNSELKVKELSR
KLTSKPDSSREIRPGGNLDLWVPVLQVSTSVTNTGSKAGSTVPQLYVSLPLETTPQGTPV
QVLRGFEKLALKPGETRKITFELLRRDVSYWDTSSQTWVIPRGKFSFKAGFSSRDIVAKA
EMELDLRD

Enzyme Prediction     

EC	3.2.1.-:5	3.2.1.21:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	78	295	5.9e-62	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396478	Glyco_hydro_3_C	2.79e-53	397	644	2	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
224389	BglX	3.18e-53	88	433	68	376	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
185053	PRK15098	1.35e-52	101	784	118	764	beta-glucosidase BglX.
395747	Glyco_hydro_3	1.92e-30	88	335	74	313	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	8.82e-29	40	741	50	740	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC76363.1|GH3	0.0	28	781	145	898
AAB08445.1|GH3|3.2.1.-	4.65e-310	36	776	43	794
AAB08446.1|GH3|3.2.1.-	4.65e-310	36	776	43	794
QKD57397.1|GH3	1.20e-296	36	779	39	801
ATZ53770.1|GH3	2.01e-290	32	779	60	823

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZYZ_A	3.10e-176	36	776	9	704	Chain A, Beta-d-glucoside Glucohydrolase [Trichoderma reesei],3ZZ1_A Chain A, BETA-D-GLUCOSIDE GLUCOHYDROLASE [Trichoderma reesei]
4I8D_A	3.20e-176	36	776	10	705	Chain A, Beta-D-glucoside glucohydrolase [Trichoderma reesei],4I8D_B Chain B, Beta-D-glucoside glucohydrolase [Trichoderma reesei]
6JXG_A	3.26e-175	36	776	6	704	Crystasl Structure of Beta-glucosidase D2-BGL from Chaetomella Raphigera [Chaetomella raphigera]
5JU6_A	1.50e-172	36	783	40	852	Chain A, Beta-glucosidase [Rasamsonia emersonii],5JU6_B Chain B, Beta-glucosidase [Rasamsonia emersonii],5JU6_C Chain C, Beta-glucosidase [Rasamsonia emersonii],5JU6_D Chain D, Beta-glucosidase [Rasamsonia emersonii]
5NBS_A	3.29e-171	36	776	36	850	Structural studies of a Glycoside Hydrolase Family 3 beta-glucosidase from the Model Fungus Neurospora crassa [Neurospora crassa OR74A],5NBS_B Structural studies of a Glycoside Hydrolase Family 3 beta-glucosidase from the Model Fungus Neurospora crassa [Neurospora crassa OR74A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B8NMR5|BGLG_ASPFN	4.01e-279	36	776	65	804	Probable beta-glucosidase G OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglG PE=3 SV=1
sp|Q2U325|BGLG_ASPOR	4.01e-279	36	776	65	804	Probable beta-glucosidase G OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglG PE=3 SV=1
sp|Q5B0F4|BGLG_EMENI	2.39e-271	36	776	66	808	Probable beta-glucosidase G OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglG PE=3 SV=2
sp|A1DC16|BGLG_NEOFI	2.06e-269	36	776	65	804	Probable beta-glucosidase G OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglG PE=3 SV=1
sp|Q0CUC1|BGLG_ASPTN	4.38e-266	36	776	65	804	Probable beta-glucosidase G OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000235	0.999748	CS pos: 18-19. Pr: 0.9695

TMHMM  Annotations     

There is no transmembrane helices in P174DRAFT_502571-t37_1-p1.