CAZyme Information: P174DRAFT_502092-t37_1-p1

Basic Information

• Species: Aspergillus novofumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus novofumigatus
• CAZyme ID: P174DRAFT_502092-t37_1-p1
• CAZy Family: GT20
• CAZyme Description: UDP-Glycosyltransferase/glycogen phosphorylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
519	MSZS01000002|CGC4	58085.96	7.2224

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnovofumigatusIBT16806	11729	1392255	197	11532

• Gene Location: location=MSZS01000002:3532282-3533841(-)

Full Sequence      

MLDARKFLIVVTAGGKTNASPIFEIAQILNTRGHKIEFATLDGQQDWAREYPFVSQVYIL
GPGQTSEAEEQAYLQMSRWKLGLRYTFEPVIETRKYLESSWETVYPALSQLVQDPVSRPD
FILADYLVDAARDMHIEHDIPIAMHWPQMPTNMVPASYLPGAAGLQMEVLTSEHATLWQR
LQNYLLAFRALPPYLRYRSWVRDLRARHGVRRPLVTRSKPDYLLLVNSFFGLEPARDLPP
NVAAIGPVLADTYPGLTPELESLLEHRNRILYISLGSHALLPDVILQRILHGALMALQDG
KAIDGIVWSIRGMALKQFNLDASVPGPHPVAAAGPLRIKDLVSGVDSIPILFAPFVPQRA
LLAHPKVSVFLTHAGASSTNEAAYHGVRTITIGVYFDQLTNAMKLRDAGVSIPLDRDTFT
PADLSRAIDALVADVSGTFVGNCERVQRIARIASRRKWLAADLIEEALADFEGRRKLGIA
DAQRGMHLQTADMRMPFWKVHNLDLWGLQRDVLSPAWDY

Enzyme Prediction     

No EC number prediction in P174DRAFT_502092-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	100	449	1.3e-26	0.743455497382199

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	3.92e-42	9	466	4	403	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	7.56e-19	6	469	3	400	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
278624	UDPGT	1.06e-12	155	507	164	468	UDP-glucoronosyl and UDP-glucosyl transferase.
215247	PLN02448	3.05e-10	117	402	107	377	UDP-glycosyltransferase family protein
223071	egt	4.45e-10	223	434	248	432	ecdysteroid UDP-glucosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR86180.1|GT1	3.90e-174	1	507	1	507
QKD56593.1|GT1	3.98e-138	5	506	8	500
UPK98814.1|GT1	1.52e-134	5	514	9	510
CAK46937.1|GT1	8.37e-134	1	514	7	494
QKX59607.1|GT1	5.50e-133	5	508	10	507

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2O6L_A	5.87e-12	355	452	75	167	Crystal Structure of the UDP-Glucuronic Acid Binding Domain of the Human Drug Metabolizing UDP-Glucuronosyltransferase 2B7 [Homo sapiens],2O6L_B Crystal Structure of the UDP-Glucuronic Acid Binding Domain of the Human Drug Metabolizing UDP-Glucuronosyltransferase 2B7 [Homo sapiens]
7CJX_A	4.63e-11	355	434	76	155	Chain A, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_B Chain B, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_C Chain C, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_D Chain D, UDP-glucuronosyltransferase 2B15 [Homo sapiens]
6IPB_A	7.47e-11	355	434	97	176	Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_B Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_C Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_D Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens]
6PNT_A	6.73e-07	355	434	324	401	Structural Characterization of UDP-glycosyltransferase from Tetranychus Urticae [Tetranychus urticae]
6JTD_A	9.60e-07	224	412	215	412	Crystal structure of TcCGT1 in complex with UDP [Trollius chinensis],6JTD_B Crystal structure of TcCGT1 in complex with UDP [Trollius chinensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P36512|UDB13_RABIT	2.64e-13	153	507	190	497	UDP-glucuronosyltransferase 2B13 OS=Oryctolagus cuniculus OX=9986 GN=UGT2B13 PE=2 SV=1
sp|Q9GLD9|UDB33_MACMU	4.62e-13	117	507	143	495	UDP-glucuronosyltransferase 2B33 OS=Macaca mulatta OX=9544 GN=UGT2B33 PE=1 SV=1
sp|Q6UWM9|UD2A3_HUMAN	1.42e-12	155	449	188	446	UDP-glucuronosyltransferase 2A3 OS=Homo sapiens OX=9606 GN=UGT2A3 PE=2 SV=2
sp|P36537|UDB10_HUMAN	1.43e-12	155	507	189	494	UDP-glucuronosyltransferase 2B10 OS=Homo sapiens OX=9606 GN=UGT2B10 PE=1 SV=1
sp|Q9TSL6|UDB23_MACFA	1.43e-12	153	451	188	450	UDP-glucuronosyltransferase 2B23 OS=Macaca fascicularis OX=9541 GN=UGT2B23 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000036	0.000000

TMHMM  Annotations     

There is no transmembrane helices in P174DRAFT_502092-t37_1-p1.