CAZyme Information: P174DRAFT_500365-t37_1-p1

Basic Information

• Species: Aspergillus novofumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus novofumigatus
• CAZyme ID: P174DRAFT_500365-t37_1-p1
• CAZy Family: GT2
• CAZyme Description: putative GMC oxidoreductase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
601	MSZS01000001|CGC3	64954.18	5.6992

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnovofumigatusIBT16806	11729	1392255	197	11532

• Gene Location: location=MSZS01000001:2540673-2542590(-)

Full Sequence      

MSCKLKLLSLLAAGLTSAVHLTGYEYIVVGSGAGGGPLAARLALAGHKTLLIEAGDDQGR
NVNYTVPAYSALASEDEKMAWNFFLRDPEGEIYTGLNPPANSTMMGTLYPRTGTLGGCTA
HNAMIAVYPDRSDFEYIATLTGDSSWSPENMRKYFVRMEHNEYLLPGQKGHGYDGWLHTD
TAPLDIVLKDPQLLSLLTGGAFALGNITHTLMNFGTLLLGDANADSLARDTQPGYYQIPL
SSTDGRRNGPREFITAVRDARNPDGSKKYPLDVRMNCHATRVVFDTSPSRPPLPTRHPGS
ATASREVIIAGGTYNSPQILKLSGVGPADELARFNIPLVADLPGVGTNLQDHYEVGVQAH
VPSNWTSLHGCTFTQSDPCLDRWESKPPLGNRGIYSSAGFAAAMFYKSTVSADNAYDAFV
FGGPVNFRGYFPGYSVNITARHDWFTWAVLKAHPRNTAGTVSLRSADPLDTPAIVFNYFD
MGADEDLQAIYEGIELARDALRRQLVPTTEVLPGAEVVSQEDVKMYVRDTAWGHHASSTC
PIGADGDPMAVLDSKFRVRKVQGLRVVDASVYPCIPGTFTAVSTYLVAEKAADDILSELA
G

Enzyme Prediction     

No EC number prediction in P174DRAFT_500365-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	23	597	4.1e-92	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	4.17e-70	24	596	6	532	choline dehydrogenase; Validated
225186	BetA	1.07e-68	24	598	8	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	4.14e-30	459	591	5	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	4.59e-17	24	578	56	559	Protein HOTHEAD
366272	GMC_oxred_N	3.76e-11	91	354	3	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW33146.1|AA3	0.0	6	599	5	645
QRD84722.1|AA3	0.0	6	599	5	645
QMW45179.1|AA3	0.0	6	599	5	645
UDD58256.1|AA3	0.0	6	599	5	645
EAA61171.1|AA3	0.0	6	600	5	644

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NNE_A	4.92e-44	24	601	14	532	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]
3LJP_A	4.92e-44	24	601	14	532	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]
2JBV_A	1.27e-43	24	601	14	532	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]
6YS2_AAA	1.77e-42	24	592	8	557	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6YRU_AAA	8.40e-42	24	592	8	557	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q66D54|BETA_YERPS	1.37e-47	24	595	3	531	Oxygen-dependent choline dehydrogenase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) OX=273123 GN=betA PE=3 SV=1
sp|B2K8U4|BETA_YERPB	1.37e-47	24	595	3	531	Oxygen-dependent choline dehydrogenase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) OX=502801 GN=betA PE=3 SV=1
sp|B1JSR0|BETA_YERPY	1.27e-46	24	595	3	531	Oxygen-dependent choline dehydrogenase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) OX=502800 GN=betA PE=3 SV=1
sp|A7FKL6|BETA_YERP3	1.27e-46	24	595	3	531	Oxygen-dependent choline dehydrogenase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) OX=349747 GN=betA PE=3 SV=1
sp|Q1CFR7|BETA_YERPN	2.41e-46	24	595	3	531	Oxygen-dependent choline dehydrogenase OS=Yersinia pestis bv. Antiqua (strain Nepal516) OX=377628 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001254	0.998740	CS pos: 18-19. Pr: 0.9645

TMHMM  Annotations     

Start	End
7	29