CAZyme Information: P174DRAFT_492649-t37_1-p1

Basic Information

• Species: Aspergillus novofumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus novofumigatus
• CAZyme ID: P174DRAFT_492649-t37_1-p1
• CAZy Family: GT2
• CAZyme Description: putative GMC oxidoreductase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
629	MSZS01000006|CGC15	67565.56	5.0043

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnovofumigatusIBT16806	11729	1392255	197	11532

• Gene Location: location=MSZS01000006:1512514-1514403(+)

Full Sequence      

MRAFYLLFVGLVAAADIHSKPNLLSYGQEGPLLGTFFGTPGADAAFDYVVVGGGNAGLTV
ASRLAQNRSVSVAVIEAGSFYEIDNGNKSIVPGYAPYFAGTDPEDYQPLIDWGFVTTPQP
GAGNRTAHYARGKTLGGSSARNFMVYHRPTADTMQRWADEVGDESYTFDKMLPYFKKSCH
YTPPDQSLYVNSTNTQTPDAFDPSGGPLQVSFGHSVDAFGTWAQRAFTAVGLEELDGLNS
GRLLGAAYVTSTIHPKNAQRSSSEASFLQDAIAKGSPPTLYLNAMAQRILFDENKVATGV
QVSTAGTFGTPPVNYTLNARKEVIVSAGAFQSPQLLMVSGVGSCNEISKFGIHCIHDLPG
VGQNLQDHAFFSSAHRVNVITASAPANDPALAARQVEQYLTNATGPLSIFGAGYYGFEKL
PEPYRSQLSEASIQALSSVPSDWPEIEWLPLNSWTGDGSNFITGDPRDGHNYATIATALA
APFSRGSVTLADASMNTPPVIDPQWLVDPTDADLAVQSFKRQRQVWEVLVRMGVADAHEA
YPGEHVQTDSQIREYLAKSIIPVFHVAGSCKMGREDDPLAVLDNTARVFGVQNLRVVDTS
SFPFITPGHPQAVVYALAEKIADDILAGR

Enzyme Prediction     

No EC number prediction in P174DRAFT_492649-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	45	626	3.5e-175	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	4.53e-93	46	627	8	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	1.36e-88	46	629	6	534	choline dehydrogenase; Validated
398739	GMC_oxred_C	3.12e-39	482	621	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	4.42e-28	37	629	47	580	Protein HOTHEAD
366272	GMC_oxred_N	2.34e-27	122	368	14	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW37598.1|AA3_2	1.33e-304	1	629	1	628
QMW25513.1|AA3_2	1.33e-304	1	629	1	628
QRD88504.1|AA3_2	1.33e-304	1	629	1	628
UCK57946.1|AA3_2	1.33e-304	1	629	1	628
QGA19805.1|AA3_2	8.72e-280	22	623	30	631

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OC1_A	3.68e-60	46	627	2	563	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	1.00e-59	44	627	1	564	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
6YS2_AAA	4.47e-51	39	622	1	557	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
4H7U_A	6.55e-51	46	619	41	591	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
6ZE2_A	8.07e-51	46	625	6	582	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1CFL2|PATE_ASPCL	4.03e-187	8	625	14	624	Patulin synthase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=patE PE=1 SV=1
sp|A0A075TRK9|PATE_PENEN	7.70e-182	19	625	28	624	Patulin synthase OS=Penicillium expansum OX=27334 GN=patE PE=1 SV=1
sp|A0A1U8QYA8|CICC_EMENI	9.83e-173	33	627	23	609	Oxidoreductase cicC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cicC PE=1 SV=1
sp|Q0CJ60|ATC_ASPTN	7.46e-163	32	627	32	595	Cyclase atC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=atC PE=1 SV=1
sp|Q5B8A1|PKFF_EMENI	1.39e-158	43	628	38	610	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.002294	0.997689	CS pos: 14-15. Pr: 0.9564

TMHMM  Annotations     

There is no transmembrane helices in P174DRAFT_492649-t37_1-p1.