CAZyme Information: P174DRAFT_464265-t37_1-p1

Basic Information

• Species: Aspergillus novofumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus novofumigatus
• CAZyme ID: P174DRAFT_464265-t37_1-p1
• CAZy Family: GH76
• CAZyme Description: putative pectate lyase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
234	MSZS01000009|CGC12	24763.55	4.4062

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnovofumigatusIBT16806	11729	1392255	197	11532

• Gene Location: location=MSZS01000009:987832-988642(+)

Full Sequence      

MWSSIAALPVLLPVALACLGYEGGVPTPTAHYSNSAVIEVAAGQVFDAGWAKYDRGSGAC
TGDSEGDWKDAVFYLHSGATLKNVIIGANQAEGVHCDGPCTLQFVWFEDVCEDAITIKND
KAGQETWIIGGGAYHASDKIVQHNGCGTVNIINFYAEDYGKVYRSCGNCDSQCKRNVYVE
GTTARDGGEVVGINLNYGDTATLKNVCADADHPCVFYDGCAGDCEPKKVGYCSG

Enzyme Prediction     

EC	4.2.2.2:5

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL3	29	219	5.9e-89	0.9896907216494846

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397360	Pectate_lyase	1.69e-115	22	224	1	200	Pectate lyase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW46280.1|PL3_2	8.37e-163	1	234	1	234
QMW34226.1|PL3_2	8.37e-163	1	234	1	234
UDD63130.1|PL3_2	8.37e-163	1	234	1	234
QRD94021.1|PL3_2	2.87e-162	1	234	35	268
BCS26321.1|PL3_2	2.85e-147	1	234	1	233

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EE6_A	6.07e-29	38	203	9	180	Crystal Structure Of Pectate Lyase From Bacillus Sp. Strain Ksm-P15. [Bacillus sp. KSM-P15]
3B90_A	2.61e-20	59	206	24	178	Chain A, Endo-pectate lyase [Dickeya chrysanthemi],3B90_B Chain B, Endo-pectate lyase [Dickeya chrysanthemi]
3B4N_A	1.45e-19	59	206	142	296	Chain A, Endo-pectate lyase [Dickeya chrysanthemi],3B4N_B Chain B, Endo-pectate lyase [Dickeya chrysanthemi],3B8Y_A Chain A, Endo-pectate lyase [Dickeya chrysanthemi],3B8Y_B Chain B, Endo-pectate lyase [Dickeya chrysanthemi]
4EW9_A	2.00e-19	38	183	14	152	The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725],4EW9_B The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725]
3T9G_A	2.04e-19	38	183	15	153	The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii],3T9G_B The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1D5E3|PLYF_NEOFI	5.06e-180	1	234	1	234	Probable pectate lyase F OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyF PE=3 SV=1
sp|B0Y953|PLYF_ASPFC	5.68e-177	1	234	1	234	Probable pectate lyase F OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyF PE=3 SV=1
sp|Q4WKV8|PLYF_ASPFU	1.90e-175	1	234	1	234	Probable pectate lyase F OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyF PE=3 SV=1
sp|B8NJZ7|PLYF_ASPFN	1.49e-163	1	234	1	234	Probable pectate lyase F OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=plyF PE=3 SV=2
sp|Q0CCF8|PLYF_ASPTN	1.74e-162	1	234	1	234	Probable pectate lyase F OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=plyF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000263	0.999711	CS pos: 17-18. Pr: 0.9728

TMHMM  Annotations     

There is no transmembrane helices in P174DRAFT_464265-t37_1-p1.