CAZyme Information: P174DRAFT_463685-t37_1-p1

Basic Information

• Species: Aspergillus novofumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus novofumigatus
• CAZyme ID: P174DRAFT_463685-t37_1-p1
• CAZy Family: GH76
• CAZyme Description: CobW domain protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
962		108082.68	4.5216

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnovofumigatusIBT16806	11729	1392255	197	11532

• Gene Location: location=MSZS01000008:884076-888491(-)

Full Sequence      

MKFLALAALFASTVSSIAVDGLIPGARVIPANDVVALKKVGADHHKHPHRRTVIIRPSCN
DKDDVSADFLLLLQKGKKYVIGKKLDLTFLKDIEVQLDGELKFTNDVPYWQANNFYYDFQ
KSISFWRWGGEDIKIFGSGTLNGNGQRWYNEFAGQEILDPNNKYYRPILFVTENATRVSV
EGITQLNSPCWTNFFVRTKDISFDNVFIHAFSTNASALPKNTDGFDTLNVDGLTVTNTRV
DIGDDCLSPKPNTTNVFVQNLWCNGTHGTSMGSIGQYPGVMDIIENVWIENVTLLNGENG
ARLKAWAGPNVGYGRINNVTYKNIHVENTDNPIVLDQCYFNINATQCAAYPSRVNFTNIV
FENIYGTSSGKHGNVVADLTCSPSAVCSGISLKNIHLTSPSGSPPVIVCDGIQGDIGVEC
QEQGSGKTTLLEHILQSPDHGLRIAVVVNDMSKLNIDAALITHHKVSQTKEKLIQLQNGC
ICCTLRGDLLSELAHLARQKEVQYVVIESTGISEPMQVAETFTAEFSTAMLQADQEMMPL
YQCLSFRFSDLTANSVNLGGLHTLARLDTTVTVVDAFNLLSNFDTAEFLSDRYGSKEIIP
EDERTISDLMVDQIEFADVLIINKIETVDENTRARIRRLLKTLNPEAKVLETSYSRVDVK
EILDTGSLHEMAIQNTGNGQRMAPKPETLEYGINNFVYTARRPFHPRRLFTLLHDKFILL
QNNEAEEDDEEGDEEGDEKEDADEGEEEEEEDDNMEVDEDDDDDDESISDFDQPDPSEIL
KNKRNHPAFGSVLRSKGFFWLATRPFQFGEWSQAGGMLTIGCGGPWFAEVPDEAWPEDPD
VRKSIENDFQEPWGDRRQEIVFIGEGINTEMITKLLDECLVDDDDMGRWAKIMNNERLSY
RQKEERLGKLWEDGWEAWPEFGIVDEDEEDNKEGGKKKHKHHTSEYLGHAHSHSHSHSHS
HK

Enzyme Prediction     

EC	3.2.1.67:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	86	414	3.2e-69	0.8830769230769231

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
223597	YejR	3.21e-70	424	880	11	321	GTPase, G3E family [General function prediction only].
349766	CobW-like	1.75e-69	424	666	10	198	cobalamin synthesis protein CobW. The function of this protein family is unknown. The amino acid sequence of YjiA protein in E. coli contains several conserved motifs that characterizes it as a P-loop GTPase. YijA gene is among the genes significantly induced in response to DNA-damage caused by mitomycin. YijA gene is a homologue of the CobW gene which encodes the cobalamin synthesis protein/P47K.
396860	cobW	5.72e-50	424	651	10	179	CobW/HypB/UreG, nucleotide-binding domain. This domain is found in HypB, a hydrogenase expression / formation protein, and UreG a urease accessory protein. Both these proteins contain a P-loop nucleotide binding motif. HypB has GTPase activity and is a guanine nucleotide binding protein. It is not known whether UreG binds GTP or some other nucleotide. Both enzymes are involved in nickel binding. HypB can store nickel and is required for nickel dependent hydrogenase expression. UreG is required for functional incorporation of the urease nickel metallocenter. GTP hydrolysis may required by these proteins for nickel incorporation into other nickel proteins. This family of domains also contains P47K, a Pseudomonas chlororaphis protein needed for nitrile hydratase expression, and the cobW gene product, which may be involved in cobalamin biosynthesis in Pseudomonas denitrificans.
395231	Glyco_hydro_28	5.10e-49	82	412	14	315	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
215426	PLN02793	3.46e-33	93	402	111	399	Probable polygalacturonase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD92857.1|GH28	3.62e-244	1	421	1	431
QMW36166.1|GH28	3.62e-244	1	421	1	431
QMW48226.1|GH28	3.62e-244	1	421	1	431
UDD65414.1|GH28	3.62e-244	1	421	1	431
UPX44877.1|GH28	2.54e-242	1	425	1	437

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C2L_A	1.30e-46	71	426	48	388	Crystal structure of endo-xylogalacturonan hydrolase from Aspergillus tubingensis [Aspergillus tubingensis]
6KVE_A	9.75e-20	130	420	75	344	Chain A, Endo-polygalacturonase [Evansstolkia leycettana]
6KVH_A	1.31e-19	130	420	75	344	Chain A, endo-polygalacturonase [Evansstolkia leycettana]
7E56_A	5.15e-19	130	420	67	336	Chain A, Endo-polygalacturonase [Evansstolkia leycettana]
1HG8_A	2.69e-18	72	367	21	304	Endopolygalacturonase from the phytopathogenic fungus Fusarium moniliforme [Fusarium verticillioides]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DAX2|PGXB_NEOFI	3.93e-299	1	421	1	432	Probable exopolygalacturonase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pgxB PE=3 SV=1
sp|Q4WBK6|PGXB_ASPFU	6.47e-278	1	428	1	439	Probable exopolygalacturonase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pgxB PE=3 SV=2
sp|B0YAA4|PGXB_ASPFC	6.47e-278	1	428	1	439	Probable exopolygalacturonase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pgxB PE=3 SV=2
sp|Q0C7H7|PGXB_ASPTN	1.32e-249	1	425	1	435	Probable exopolygalacturonase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pgxB PE=3 SV=1
sp|B8NX60|PGXB_ASPFN	6.43e-245	1	421	1	431	Probable exopolygalacturonase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pgxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000345	0.999615	CS pos: 16-17. Pr: 0.9759

TMHMM  Annotations     

There is no transmembrane helices in P174DRAFT_463685-t37_1-p1.