CAZyme Information: P174DRAFT_463337-t37_1-p1

Basic Information

• Species: Aspergillus novofumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus novofumigatus
• CAZyme ID: P174DRAFT_463337-t37_1-p1
• CAZy Family: GH72|CBM43
• CAZyme Description: putative extracellular exo-polygalacturonase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
366		37826.40	7.0948

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnovofumigatusIBT16806	11729	1392255	197	11532

• Gene Location: location=MSZS01000007:1964574-1965840(+)

Full Sequence      

MPYYRNLALLPLLGLSIAAPSQVERSPDSVFKPRAVCTPTAGGSSSIDDVPAIRKAISSC
GNGGTIVFPAGSTYYLNSVLDLAGCSNCDMQVEGLLKFSGSTDYWGGKTAMININKINGL
KLRSLTGSGVIDGNGQNAYDLFASNSSYDRPTLLYISGGSNIEVSGLRQKNPRITHVTIS
SVNVSNDDDCVALKPGCNYVTVEDVTCTGSHGISVGSLGKSSADTVQNAYLHRITMIDST
KAAGIKTYPSGNGHGLSTVKNVTFSDFTVQGCDYAFQIQSCYGESASYCASNPGNAILQD
IIVKGFSGTTSGKNDPVVANLNCGASGTCDVSISDFRVKAPSGKATVLCANTPSSLGVTC
TSGASG

Enzyme Prediction     

EC	3.2.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	174	353	4.2e-37	0.52

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395231	Glyco_hydro_28	3.57e-27	60	354	1	317	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
177865	PLN02218	3.34e-20	41	351	75	419	polygalacturonase ADPG
215540	PLN03010	2.33e-19	41	351	54	388	polygalacturonase
215120	PLN02188	1.30e-14	41	351	44	389	polygalacturonase/glycoside hydrolase family protein
178580	PLN03003	1.55e-13	41	313	31	334	Probable polygalacturonase At3g15720

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAL85450.1|GH28|3.2.1.-	2.42e-220	1	366	4	409
ASO96840.1|GH28	7.61e-214	1	366	1	406
QMW43960.1|GH28	2.93e-190	6	366	6	406
QRD90994.1|GH28	2.93e-190	6	366	6	406
QMW31926.1|GH28	2.93e-190	6	366	6	406

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C2L_A	2.02e-182	19	366	1	388	Crystal structure of endo-xylogalacturonan hydrolase from Aspergillus tubingensis [Aspergillus tubingensis]
6KVH_A	8.60e-20	26	360	1	344	Chain A, endo-polygalacturonase [Evansstolkia leycettana]
6KVE_A	1.17e-19	26	360	1	344	Chain A, Endo-polygalacturonase [Evansstolkia leycettana]
7E56_A	6.85e-19	66	360	26	336	Chain A, Endo-polygalacturonase [Evansstolkia leycettana]
1NHC_A	3.20e-18	35	354	1	332	Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_B Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_C Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_D Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_E Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_F Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DBT5|XGHA_NEOFI	9.69e-238	1	366	1	406	Probable endo-xylogalacturonan hydrolase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=xghA PE=3 SV=1
sp|Q4WBT4|XGHA_ASPFU	3.85e-221	1	366	1	406	Probable endo-xylogalacturonan hydrolase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=xghA PE=3 SV=2
sp|B0Y9F8|XGHA_ASPFC	1.56e-220	1	366	1	406	Probable endo-xylogalacturonan hydrolase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=xghA PE=3 SV=2
sp|B8NPS8|XGHA_ASPFN	5.20e-191	6	366	6	406	Probable endo-xylogalacturonan hydrolase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=xghA PE=3 SV=1
sp|Q2UBD8|XGHA_ASPOR	8.56e-190	6	366	6	406	Probable endo-xylogalacturonan hydrolase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=xghA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000585	0.999399	CS pos: 25-26. Pr: 0.8424

TMHMM  Annotations     

There is no transmembrane helices in P174DRAFT_463337-t37_1-p1.