CAZyme Information: P174DRAFT_462901-t37_1-p1

Basic Information

• Species: Aspergillus novofumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus novofumigatus
• CAZyme ID: P174DRAFT_462901-t37_1-p1
• CAZy Family: GH72|CBM43
• CAZyme Description: putative glucuronyl hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
511		57109.84	7.0350

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnovofumigatusIBT16806	11729	1392255	197	11532

• Gene Location: location=MSZS01000007:594435-596032(+)

Full Sequence      

MGSGRANVLGHDSSERRYSGSDKHHKHRKHPRSSLIHPIILNLTNCKMTVDVANHQIKSY
GSQPLEKIFSENVLAKILRVAVEALNNNDPPTEYPEFVPQKGPSTGRYILRESSFWTCGF
FPGLLYLLLERAIRYPSTFPYLRRTHTLDPVSLRDDLVTLCTKWTAPIYPMSLRTDTHDL
GFILAPSLRRSWELTSNPESLRALLTGAQSLASRFVPSTGAIRSWDALRQSDVDITSLET
DCLVIIDSMMNLDLLYYAAAHLGPELAAIATTHAKTLINSHLRKESIAGKQILAYNTIHV
VNFDPATGAIKERRTAQGYAADSTWARGQAWAITGYAQTYAWTRDRQFLDVAIGLAEYFL
TRLEGAPACVEKMVDGRMVGRYVPLWDFDAPVDEASPLRDSSAGVIAANGMLLLSQALVG
EDEGLARRFRDAAMRIVSETVEFSYSREEARLVDRGQQVEDVSGTRFDAILRNATANHNA
KDLDRYSDHGLVYADYYLLEFGNQLLKLGLI

Enzyme Prediction     

No EC number prediction in P174DRAFT_462901-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH88	111	500	5.2e-86	0.9726443768996961

CDD Domains     

P174DRAFT_462901-t37_1-p1 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS27314.1|GH88	3.69e-213	65	509	7	460
EAA59462.1|GH88	7.91e-193	61	511	8	489
QPC58692.1|GH88	1.66e-171	62	510	34	485
CEF77270.1|GH88	6.70e-171	62	510	34	485
QPC70096.1|GH88	9.49e-171	62	510	34	485

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WIW_A	3.62e-39	57	500	15	383	Crystal structure of unsaturated glucuronyl hydrolase specific for heparin [Pedobacter heparinus DSM 2366]
1VD5_A	9.82e-27	99	438	25	315	Crystal Structure of Unsaturated Glucuronyl Hydrolase, Responsible for the Degradation of Glycosaminoglycan, from Bacillus sp. GL1 at 1.8 A Resolution [Bacillus sp. GL1],2D5J_A Unsaturated Glucuronyl Hydrolase Triggers Hydration of Vinyl Ether Group but not of Glycosidic Bond [Bacillus sp. GL1],2D5J_B Unsaturated Glucuronyl Hydrolase Triggers Hydration of Vinyl Ether Group but not of Glycosidic Bond [Bacillus sp. GL1],2FUZ_A UGL hexagonal crystal structure without glycine and DTT molecules [Bacillus sp. GL1]
2AHF_A	4.57e-26	99	438	25	315	Chain A, unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2AHF_B Chain B, unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2AHG_A Chain A, unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2AHG_B Chain B, unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2FV0_A Chain A, Unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2FV0_B Chain B, Unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2FV1_A Chain A, Unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2FV1_B Chain B, Unsaturated glucuronyl hydrolase [Bacillus sp. GL1]
2ZZR_A	1.70e-24	61	500	19	384	Crystal structure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae]
3ANJ_A	1.72e-24	61	500	20	385	Crystal structure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|T2KLZ3|PLH1_FORAG	3.47e-30	39	500	9	389	Unsaturated glucuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21900 PE=1 SV=1
sp|Q9A0T3|UCDH_STRP1	1.19e-29	52	500	8	386	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pyogenes serotype M1 OX=301447 GN=ugl PE=1 SV=1
sp|Q9RC92|UGL_BACGL	5.05e-26	99	438	25	315	Unsaturated glucuronyl hydrolase OS=Bacillus sp. (strain GL1) OX=84635 GN=ugl PE=1 SV=1
sp|Q8DR77|UCDH_STRR6	3.05e-25	94	500	45	383	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=ugl PE=1 SV=1
sp|Q8E372|UCDH_STRA3	8.87e-24	61	500	20	385	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=gbs1889 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000042	0.000001

TMHMM  Annotations     

There is no transmembrane helices in P174DRAFT_462901-t37_1-p1.