CAZyme Information: P174DRAFT_462750-t37_1-p1

Basic Information

• Species: Aspergillus novofumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus novofumigatus
• CAZyme ID: P174DRAFT_462750-t37_1-p1
• CAZy Family: GH72
• CAZyme Description: FAD binding domain protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
575		62819.29	8.4503

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnovofumigatusIBT16806	11729	1392255	197	11532

• Gene Location: location=MSZS01000007:129964-131781(-)

Full Sequence      

MKSLLLAIFFATAAIAAPESRRCRCQPHQPCWPSPQEWNALNRSIDGNLVAVQPVAAPCH
INPNSTACQEVTAQWSNSVWRAAQPGALQWENWGAWPEHNESCFIETAPYVCMQGRISLY
SAVVQNARHIQEAVRFARRHNIRLAVKNSGHDFLGRSAAPNSLQILTNRMKGLQTVNDFV
PKGRRDTKAKEMYAALGKQNRTVVGGTAHTVGPTGGYIQGGGHSLLSPWKGMASDNALEF
SVVTASGDLVTANAYQNSDLFWALRGGGGGTFGIVTQVTVRTFEEIPLVVTTMNITTAGG
DPAFWTAVADFHAALPAVTDVRGGGYYFMVPNLPWENNQTLSVLSFYLFHTNTSNTTEVG
QMYEPLMKKLNATAGVYTQYMTIPMPSFHEAMSKLMLVGDSDATGSIALLFSRLFSKDLL
TSKDGPARLASTMSKFRYTPGEAVTGMVVGGGAVAENAGKVDSALNPAWRKAVVHVAYTR
SWSANATLAEQQAVLKNVTDVELPLLQGVEGADKMGAYVNEAFAYEPNFQESFWGGNYRR
LYRIKQRWDPAGLFIARRMVGSEDWDEQGLCRVAK

Enzyme Prediction     

EC	1.1.3.-:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	122	555	1.4e-52	0.9475982532751092

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
223354	GlcD	3.91e-15	121	335	33	253	FAD/FMN-containing dehydrogenase [Energy production and conversion].
396238	FAD_binding_4	2.65e-14	121	253	2	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
369658	BBE	1.74e-10	517	554	1	38	Berberine and berberine like. This domain is found in the berberine bridge and berberine bridge- like enzymes which are involved in the biosynthesis of numerous isoquinoline alkaloids. They catalyze the transformation of the N-methyl group of (S)-reticuline into the C-8 berberine bridge carbon of (S)-scoulerine.
215242	PLN02441	0.002	121	276	66	232	cytokinin dehydrogenase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD57322.1|GH43_11	7.62e-53	23	566	500	1055
QKD57322.1|CBM91|GH43_11	7.62e-53	23	566	500	1055
QRC92907.1|AA7	8.19e-18	122	562	67	492
CAE7214923.1|AA7	1.02e-14	122	562	67	491
UQC87672.1|AA7	1.83e-14	116	562	65	497

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6F72_A	4.92e-78	20	575	25	573	Crystal structure of VAO-type flavoprotein MtVAO615 at pH 7.5 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F73_A Crystal structure of VAO-type flavoprotein MtVAO615 at pH 5.0 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F73_B Crystal structure of VAO-type flavoprotein MtVAO615 at pH 5.0 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464]
6F74_A	6.76e-52	17	572	24	597	Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F74_B Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F74_C Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F74_D Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464]
4DNS_A	8.90e-18	119	289	56	231	Crystal structure of Bermuda grass isoallergen BG60 provides insight into the various cross-allergenicity of the pollen group 4 allergens [Cynodon dactylon],4DNS_B Crystal structure of Bermuda grass isoallergen BG60 provides insight into the various cross-allergenicity of the pollen group 4 allergens [Cynodon dactylon]
4PVK_A	4.97e-17	119	289	54	229	Phl p 4 I153V N158H variant, a glucose oxidase [Phleum pratense],4PWC_A Phl p 4 I153V N158H variant, a glucose oxidase, 3.5 M NaBr soak [Phleum pratense]
4PVH_A	6.61e-17	119	289	54	229	Phl p 4 N158H variant, a glucose dehydrogenase [Phleum pratense]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AS41|A7056_ARTBC	1.55e-183	10	572	13	587	Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07056 PE=1 SV=2
sp|L0E159|MALF_MALAU	3.67e-129	14	571	13	576	FAD-linked oxidoreductase malF OS=Malbranchea aurantiaca OX=78605 GN=malF PE=1 SV=1
sp|E1ACP9|NOTD_ASPSM	3.10e-116	1	571	4	587	FAD-linked oxidoreductase notD OS=Aspergillus sp. (strain MF297-2) OX=877550 GN=notD PE=1 SV=1
sp|L7WR40|NOTD_ASPVE	3.49e-116	1	573	4	581	FAD-linked oxidoreductase notD' OS=Aspergillus versicolor OX=46472 GN=notD' PE=1 SV=1
sp|W6R4D7|IFGC_PENRF	1.96e-109	23	575	28	603	FAD-linked oxidoreductase ifgC OS=Penicillium roqueforti (strain FM164) OX=1365484 GN=ifgC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000247	0.999739	CS pos: 16-17. Pr: 0.9759

TMHMM  Annotations     

There is no transmembrane helices in P174DRAFT_462750-t37_1-p1.