CAZyme Information: P174DRAFT_462734-t37_1-p1

Basic Information

• Species: Aspergillus novofumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus novofumigatus
• CAZyme ID: P174DRAFT_462734-t37_1-p1
• CAZy Family: GH71|CBM24|CBM24
• CAZyme Description: putative endoglucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
232	MSZS01000007|CGC7	23891.60	4.7434

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnovofumigatusIBT16806	11729	1392255	197	11532

• Gene Location: location=MSZS01000007:90066-90834(-)

Full Sequence      

MVCFILLQTMTNQRDSDTMTGKKELVAVEHHLLGIGNGVYTAAGSQALFDTAGASWCGAG
CGKCYNLTSTGNPPCSGCGTGGAAGKSIIVMVTNLCPYNGNQQWCPQVGATNSYGYSYHF
DIMAQSEVFGDNVVVNFEPVTCPGQATSDWETCVCYGKTATDETPVGMTPGGSNPSPPTS
TTSTKTTTTTTTAGATQTLYGQCGGSGWTGPTACASGATCKVLNSYYSQCLS

Enzyme Prediction     

EC	3.2.1.4:3	3.2.1.4:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM1	200	227	4.2e-16	0.9310344827586207

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
409015	DPBB_GH45_endoglucanase	6.24e-24	40	142	38	149	double-psi beta-barrel fold of glycoside hydrolase family 45 endoglucanase EG27II and similar proteins. This group is made up of endoglucanases from mollusks similar to Ampullaria crossean endoglucanase EG27II, a glycoside hydrolase family 45 (GH45) subfamily B protein. Endoglucanases (EC 3.2.1.4) catalyze the endohydrolysis of (1-4)-beta-D-glucosidic linkages in cellulose, lichenin, and cereal beta-D-glucans. Animal cellulases, such as endoglucanase EG27II, have great potential for industrial applications such as bioethanol production. GH45 endoglucanases from mollusks adopt a double-psi beta-barrel (DPBB) fold.
395595	CBM_1	4.21e-11	199	227	1	29	Fungal cellulose binding domain.
197593	fCBD	7.31e-10	198	231	1	34	Fungal-type cellulose-binding domain. Small four-cysteine cellulose-binding domain of fungi
409011	DPBB_EXPA_N	1.31e-07	36	105	32	95	N-terminal double-psi beta-barrel fold domain of the alpha-expansin subfamily. Alpha-expansins (EXPA, expansin-A) have cell wall loosening activity and are involved in cell expansion and other developmental events during which cell wall modification occurs. They also affect environmental stress responses. Arabidopsis thaliana EXPA1 is a cell wall modifying enzyme that controls the divisions marking lateral root initiation. Nicotiana tabacum EXPA4 positively regulates abiotic stress tolerance, and negatively regulates pathogen resistance. Wheat TaEXPA2 is involved in conferring cadmium tolerance. Alpha-expansins belong to the expansin family of proteins that contain an N-terminal domain (D1) homologous to the catalytic domain of glycoside hydrolase family 45 (GH45) proteins but with no hydrolytic activity, and a C-terminal domain (D2) homologous to group-2 grass pollen allergens. This model represents the N-terminal domain of alpha-expansins, which adopts a double-psi beta-barrel (DPBB) fold.
409008	DPBB_EXP_N-like	6.14e-07	40	122	33	92	N-terminal double-psi beta-barrel fold domain of the expansin family and similar domains. The plant expansin family consists of four subfamilies, alpha-expansin (EXPA), beta-expansin (EXPB), expansin-like A (EXLA), and expansin-like B (EXLB). EXPA and EXPB display cell wall loosening activity and are involved in cell expansion and other developmental events during which cell wall modification occurs. EXPA proteins function more efficiently on dicotyledonous cell walls, whereas EXPB proteins exhibit specificity for the cell walls of monocotyledons. Expansins also affect environmental stress responses. Expansin family proteins contain an N-terminal domain (D1) homologous to the catalytic domain of glycoside hydrolase family 45 (GH45) proteins but with no hydrolytic activity, and a C-terminal domain (D2) homologous to group-2 grass pollen allergens. This family also includes GH45 endoglucanases from mollusks. This model represents the N-terminal domain of expansins and similar proteins, which adopts a double-psi beta-barrel (DPBB) fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA20713.1|CBM1|GH45	6.33e-111	33	231	47	251
UKZ88838.1|CBM1|GH45	4.46e-103	33	232	47	248
AGW24295.1|CBM1|GH45	1.35e-101	33	231	47	265
ACF33814.1|CBM1|GH45|3.2.1.4	1.35e-101	33	231	47	265
UKZ63968.1|CBM1|GH45	3.34e-100	33	231	48	246

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XBU_A	2.91e-22	40	156	56	181	Crystal structure of GH45 endoglucanase EG27II in apo-form [Ampullaria crossean],5XBX_A Crystal structure of GH45 endoglucanase EG27II in complex with cellobiose [Ampullaria crossean],5XC4_A Crystal structure of GH45 endoglucanase EG27II at pH4.0, in complex with cellobiose [Ampullaria crossean],5XC8_A Crystal structure of GH45 endoglucanase EG27II at pH5.5, in complex with cellobiose [Ampullaria crossean],5XC9_A Crystal structure of GH45 endoglucanase EG27II at pH8.0, in complex with cellobiose [Ampullaria crossean]
5XCA_A	4.30e-21	40	156	56	181	Crystal structure of GH45 endoglucanase EG27II D137A mutant in complex with cellobiose [Ampullaria crossean]
1WC2_A	1.13e-15	38	152	46	167	Chain A, ENDOGLUCANASE [Mytilus edulis]
1CBH_A	1.12e-13	196	231	1	36	Chain A, C-TERMINAL DOMAIN OF CELLOBIOHYDROLASE I [Trichoderma reesei],2CBH_A Chain A, C-TERMINAL DOMAIN OF CELLOBIOHYDROLASE I [Trichoderma reesei],2MWJ_A Chain A, Exoglucanase 1 [Trichoderma reesei],2MWK_A Chain A, Exoglucanase 1 [Trichoderma reesei],5X34_A Chain A, Exoglucanase 1 [Trichoderma reesei],5X35_A Chain A, Exoglucanase 1 [Trichoderma reesei],5X36_A Chain A, Exoglucanase 1 [Trichoderma reesei],5X37_A Chain A, Exoglucanase 1 [Trichoderma reesei],5X38_A Chain A, Exoglucanase 1 [Trichoderma reesei]
6MVI_A	3.58e-13	54	230	105	292	Apo Cel45A from Neurospora crassa OR74A [Neurospora crassa OR74A],6MVJ_A Cellobiose complex Cel45A from Neurospora crassa OR74A [Neurospora crassa OR74A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P43317|GUN5_HYPJE	4.09e-100	33	231	46	241	Endoglucanase-5 OS=Hypocrea jecorina OX=51453 GN=egl5 PE=3 SV=1
sp|P82186|GUN_MYTED	5.81e-15	38	152	46	167	Endoglucanase OS=Mytilus edulis OX=6550 PE=1 SV=1
sp|Q9P8P3|GUX1_TRIHA	9.57e-14	165	231	438	505	Exoglucanase 1 OS=Trichoderma harzianum OX=5544 GN=cbh1 PE=1 SV=1
sp|P19355|GUX1_HYPRU	1.98e-12	135	231	438	514	Exoglucanase 1 OS=Hypocrea rufa OX=5547 GN=cbh1 PE=3 SV=2
sp|G2Q9T3|CEL61_MYCTT	8.62e-12	193	231	304	342	Polysaccharide monooxygenase Cel61a OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Cel61a PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.779923	0.220077

TMHMM  Annotations     

There is no transmembrane helices in P174DRAFT_462734-t37_1-p1.