CAZyme Information: P174DRAFT_460012-t37_1-p1

Basic Information

• Species: Aspergillus novofumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus novofumigatus
• CAZyme ID: P174DRAFT_460012-t37_1-p1
• CAZy Family: GH7
• CAZyme Description: putative mannosyl-oligosaccharide alpha-1,2-mannosidase 1B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
503	MSZS01000004|CGC1	55309.84	4.8382

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnovofumigatusIBT16806	11729	1392255	197	11532

• Gene Location: location=MSZS01000004:1115371-1116995(+)

Full Sequence      

MHLPSLSVALALVSSSLALPQTVLPENDVSSRAAAVKEAFSHAWDGYMKYAFPHDELLPI
SNSYGDSRNGWGASAVDALSTAIVMRNATIVNQILDHIAKIDYSKTSDTVSLFETTIRYL
GGMLSGYDLLKGPAANLVKDSTKVDMLLQQSKNLGDVLKFAFDTPSGVPYNNINITSHGN
DGATTNGLAVTGTLVLEWTRLSDLTGDQEYAKLSQRAESYLLAPQPSSGEPFPGLVGSEI
SIQTGQFTNGFVSWNGGSDSFYEYLMKMYVYDPKRFATYKDRWVAAAESSIGRLASNPAS
RPDLTFLATYNKGSLGLSSQHLACFDGGSYLLGGTVLDRTDLIDFGLKLVDGCADTYHQT
LTGIGPESFGWDEKSVPADQKEFYERAGFYVQSGAYILRPEVIESFYYAYRVTGKKQYRD
WVWKAFENINKYCRTGSGFAGLTDVNAVNGGNRYDNQESFLFAEVMKYAYLTHAPGMSPI
SIVDEDKANEEQRMNGRFNGEWQ

Enzyme Prediction     

EC	3.2.1.113:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	39	475	9.4e-129	0.952914798206278

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	0.0	39	475	1	433	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	1.05e-115	23	475	61	498	glycoside hydrolase family 47 protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAS77884.1|GH47	0.0	1	475	1	475
BAE57653.1|GH47|3.2.1.113	1.21e-271	1	475	1	483
BAC07247.1|GH47|3.2.1.113	1.21e-271	1	475	1	483
QRD82359.1|GH47	1.21e-271	1	475	1	483
QMW39988.1|GH47	1.21e-271	1	475	1	483

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2RI8_A	2.19e-257	31	474	4	447	Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI8_B Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI9_A Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum],2RI9_B Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum]
1KKT_A	5.79e-257	10	474	12	482	Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KKT_B Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KRE_A Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRE_B Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_A Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_B Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum]
1HCU_A	3.82e-155	31	474	14	466	Chain A, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_B Chain B, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_C Chain C, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_D Chain D, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei]
5KKB_A	9.53e-58	29	471	19	443	Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus],5KKB_B Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus]
1NXC_A	1.16e-57	29	471	17	441	Structure of mouse Golgi alpha-1,2-mannosidase IA reveals the molecular basis for substrate specificity among Class I enzymes (family 47 glycosidases) [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1D1W1|MNS1B_NEOFI	0.0	1	492	1	492	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=mns1B PE=3 SV=1
sp|Q4WRZ5|MNS1B_ASPFU	0.0	1	492	1	492	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mns1B PE=3 SV=1
sp|B0XMT4|MNS1B_ASPFC	0.0	1	492	1	492	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=mns1B PE=3 SV=1
sp|A1CP08|MNS1B_ASPCL	2.59e-292	1	474	1	477	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mns1B PE=3 SV=1
sp|Q0D076|MNS1B_ASPTN	3.65e-275	1	474	1	481	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mns1B PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000263	0.999714	CS pos: 32-33. Pr: 0.5660

TMHMM  Annotations     

There is no transmembrane helices in P174DRAFT_460012-t37_1-p1.