CAZyme Information: P174DRAFT_459140-t37_1-p1

Basic Information

• Species: Aspergillus novofumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus novofumigatus
• CAZyme ID: P174DRAFT_459140-t37_1-p1
• CAZy Family: GH63
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
238		25859.86	4.3959

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnovofumigatusIBT16806	11729	1392255	197	11532

• Gene Location: location=MSZS01000003:2383877-2384706(+)

Full Sequence      

MTPGTGTTAGGVNWVGYLTTAENACLVLSYDLAVGGATIDGSLVGSTANDLVGQLRTFDA
TYSSKPASAPWTSGDAVFAFWIGINDIGNAYYRTNASTFVPQLIGRLEDLAEDIYNSGGR
KFLFVNVPPINRTPMFIQQGDWAIEHSAAYLAVYNQQLATMVERFKSSNTGVIAVLYDSW
SFMTKVLDNPTDYGFPDATCINGDGTSCVWWNDYHPGTKYHQRQAEDMKASLSPLGAW

Enzyme Prediction     

No EC number prediction in P174DRAFT_459140-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE16	4	228	2.4e-87	0.8764044943820225

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238882	fatty_acyltransferase_like	3.93e-51	13	230	40	269	Fatty acyltransferase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Might catalyze fatty acid transfer between phosphatidylcholine and sterols.
238875	SGNH_plant_lipase_like	1.42e-24	33	216	81	299	SGNH_plant_lipase_like, a plant specific subfamily of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
395531	Lipase_GDSL	7.95e-11	30	226	46	222	GDSL-like Lipase/Acylhydrolase.
225780	COG3240	4.61e-08	31	233	110	334	Phospholipase/lecithinase/hemolysin [Lipid transport and metabolism, General function prediction only].
178701	PLN03156	3.33e-07	82	222	165	336	GDSL esterase/lipase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW25447.1|CE16	1.14e-123	4	238	63	298
QMW37516.1|CE16	1.14e-123	4	238	63	298
UCK57868.1|CE16	1.14e-123	4	238	63	298
QRD88580.1|CE16	6.91e-119	4	238	63	313
BCS24928.1|CE16	1.90e-116	4	236	61	292

PDB Hits     

P174DRAFT_459140-t37_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G2QJ27|AES1_MYCTT	2.79e-54	7	226	68	291	Acetylesterase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=aes1 PE=3 SV=1
sp|T2FKR1|AES1_THETO	2.79e-54	7	226	68	291	Acetylesterase OS=Thermothelomyces thermophilus OX=78579 GN=aes1 PE=1 SV=1
sp|P86276|GDL1_CARPA	5.22e-12	29	195	95	269	GDSL esterase/lipase OS=Carica papaya OX=3649 PE=1 SV=1
sp|H6U1I8|GLIP_TANCI	8.79e-11	75	203	158	291	GDSL lipase OS=Tanacetum cinerariifolium OX=118510 GN=GLIP PE=1 SV=1
sp|Q9FLN0|GLIP1_ARATH	7.43e-10	23	203	108	307	GDSL esterase/lipase 1 OS=Arabidopsis thaliana OX=3702 GN=GLIP1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999882	0.000174

TMHMM  Annotations     

There is no transmembrane helices in P174DRAFT_459140-t37_1-p1.