CAZyme Information: P174DRAFT_457246-t37_1-p1

Basic Information

• Species: Aspergillus novofumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus novofumigatus
• CAZyme ID: P174DRAFT_457246-t37_1-p1
• CAZy Family: GH53
• CAZyme Description: putative cellulase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
570	MSZS01000002|CGC9	61877.29	7.2174

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnovofumigatusIBT16806	11729	1392255	197	11532

• Gene Location: location=MSZS01000002:512546-514533(-)

Full Sequence      

MKGLQVAALVALVRSAWAQAGNCPGTFTSISAADFVSRVHPGWNLGNTLDAVPNEGSWNN
APVQASTFDTVKSAGFKSVRLPVTWAHHFTGESPDWTVDPAWLQRVSDVLDMITSRGLYA
IVNVHHDSWIWADVTQSGANLTMIEEKFYRLWYQIGTKLGCKSNMVAFESINEPPVNNAQ
DAAEINKLNEIFLQAINKAGGFNSKRVVNLVGGGQDSIKTSQWFKAPSGFSNPYAIQFHY
YSPYDFIFGAWGKTIWGSDSDKAALTNDFKLLRNNFTNVPIILGEYDASPTNTEPAARWK
YNDLLAHAAAQYNFATILWDNGLDHLDRTTGKWRDPTSLQIITKTKSSTKNSLPDSTTDA
SATSQSSSAYIFHQVGTPVTSQTLPFIFNGNTLQSIKESSGTTLKQGTDYSVSGSNIIFT
ASYLSKRISATTQPGIITDLTLTFSSGASPVVQLVQWQTPTLGSTSVAASSVSGDLSIPI
TWGGVPKIAAVKALTTSGKYLVDDWTQYLGPLQQARTTYSSQWKFEGANVFLTSGAIDAV
KSAGQTTVFTFEFYPRVAGGANTVNFTVTV

Enzyme Prediction     

EC	3.2.1.-:12	3.2.1.4:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	55	322	2.3e-68	0.9891304347826086
CBM46	367	449	4.6e-17	0.9195402298850575

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395098	Cellulase	1.39e-34	49	322	10	269	Cellulase (glycosyl hydrolase family 5).
397483	CBM_X2	3.49e-22	370	453	6	82	Carbohydrate binding domain X2. This domain binds to cellulose and to bacterial cell walls. It is found in glycosyl hydrolases and in scaffolding proteins of cellulosomes (multiprotein glycosyl hydrolase complexes). In the cellulosome it may aid cellulose degradation by anchoring the cellulosome to the bacterial cell wall and by binding it to its substrate. This domain has an Ig-like fold.
225344	BglC	3.27e-19	40	322	52	360	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP96338.1|GH5_4	1.61e-307	23	570	26	574
QQK43655.1|GH5_4	6.31e-307	3	570	24	592
AFG25592.1|CBM1|GH5_4|3.2.1.4	4.92e-303	22	570	105	655
AIO06743.1|CBM1|GH5_4	4.92e-303	22	570	105	655
EAA59690.1|GH5_4	8.57e-300	4	570	5	572

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YZP_A	6.88e-100	30	556	22	524	Crystal structure of a tri-modular GH5 (subfamily 4) endo-beta-1, 4-glucanase from Bacillus licheniformis [Bacillus licheniformis],4YZT_A Crystal structure of a tri-modular GH5 (subfamily 4) endo-beta-1, 4-glucanase from Bacillus licheniformis complexed with cellotetraose [Bacillus licheniformis]
5E0C_A	3.53e-48	35	508	13	479	Structural Insight of a Trimodular Halophilic Cellulase with a Family 46 Carbohydrate-Binding Module [Bacillus sp. BG-CS10]
5XRC_A	7.53e-48	35	508	46	512	A Trimodular GH5_4 Subfamily Endoglucanase Structure with Large Unit Cell [Bacillus sp. BG-CS10],5XRC_B A Trimodular GH5_4 Subfamily Endoglucanase Structure with Large Unit Cell [Bacillus sp. BG-CS10],5XRC_C A Trimodular GH5_4 Subfamily Endoglucanase Structure with Large Unit Cell [Bacillus sp. BG-CS10]
5E09_A	4.60e-47	35	508	13	479	Structural Insight of a Trimodular Halophilic Cellulase with a Family 46 Carbohydrate-Binding Module [Bacillus sp. BG-CS10]
4IM4_A	2.49e-46	30	342	5	331	Chain A, Endoglucanase E [Acetivibrio thermocellus],4IM4_B Chain B, Endoglucanase E [Acetivibrio thermocellus],4IM4_C Chain C, Endoglucanase E [Acetivibrio thermocellus],4IM4_D Chain D, Endoglucanase E [Acetivibrio thermocellus],4IM4_E Chain E, Endoglucanase E [Acetivibrio thermocellus],4IM4_F Chain F, Endoglucanase E [Acetivibrio thermocellus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P23550|GUNB_PAELA	2.84e-54	6	551	16	544	Endoglucanase B OS=Paenibacillus lautus OX=1401 GN=celB PE=3 SV=1
sp|P10477|CELE_ACET2	4.23e-43	30	342	55	381	Cellulase/esterase CelE OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celE PE=1 SV=2
sp|P16218|GUNH_ACET2	7.24e-40	29	323	326	602	Endoglucanase H OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celH PE=1 SV=1
sp|O08342|GUNA_PAEBA	2.30e-39	29	324	37	371	Endoglucanase A OS=Paenibacillus barcinonensis OX=198119 GN=celA PE=1 SV=1
sp|P25472|GUND_RUMCH	8.18e-39	27	323	23	301	Endoglucanase D OS=Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) OX=394503 GN=celCCD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000207	0.999772	CS pos: 20-21. Pr: 0.6974

TMHMM  Annotations     

There is no transmembrane helices in P174DRAFT_457246-t37_1-p1.