CAZyme Information: P174DRAFT_457138-t37_1-p1

Basic Information

• Species: Aspergillus novofumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus novofumigatus
• CAZyme ID: P174DRAFT_457138-t37_1-p1
• CAZy Family: GH51
• CAZyme Description: chitin synthase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
877	MSZS01000002|CGC34	99157.66	8.5017

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnovofumigatusIBT16806	11729	1392255	197	11532

• Gene Location: location=MSZS01000002:210263-213214(+)

Full Sequence      

MGTPTPYSAHSPQESRSSFYSQPSPSPTLTYGRDDAEDQQQTLLRRSVASPNGWSYDDPN
ISTDSLRRYTLHDPGITAFAHPYPESETADVHSARMSEYSGIEMDAWQRRQGLKPSALRR
YGTRKINLVQGSVLSVDYPVPSAIQNAIQAEYRDAEEAFHEEFTHMRYTAATCDPDEFTL
RNGYNLRPAMYNRHTELLIAITYYNEDKVLTARTLHGVMQNVRDIVNLKKSEFWNKGGPA
WQKIVVCLVFDGIEPCDKNTLDVLATIGVYQDGVMKKDVDGRETVAHIFEYTTQLSVTAT
QQLMIFCLKQKNSKKINSHRWLFNAFSRILNPEICILLDAGTKPGSKSLLALWEAFYNDK
TLGGACGEIHAMLGKGWRNVLNPLVAAQNFEYKISNILDKPLESAFGYVSVLPGAFSAYR
YRAIMGRPLEQYFHGDHTLSKRLGKKGIEGMNIFKKNMFLAEDRILCFELVAKAGFKWHL
TYVKASKGETDVPEAAPEFISQRRRWLNGSFAASLYAIMHFGRIYKSGHSLVRMFFLHIQ
MIYNCCQLIMTWFSLASYWLTSSVIMDLVGTPSSHNKNKAWPFGNDATPIVNFFVKYGYL
LALMLQFVLALGNRPKGTKFAYTMSFLWFSLVQFYVLILSFYLVANAFMGGMMDFDFDQG
VGHFLSSFFSSSGGGIVLIALVSTYGIYIVASILYMDPWHILTSSWAYFLGMTTSINILM
VYAFCNWHDVSWGTKGSDKADALPSAQTKKADGSKSNFIEEVDKPQADIDSQFEATVKRA
LAPYQEPKEDSTISMDDSYRNFRTNLVLLWILSNLLVSLLITSDGIRKMALTNTSTTRTQ
YYFQVILWATAGLSIFRFIGSLYFLGKSGILCCVARR

Enzyme Prediction     

EC	2.4.1.16:26	2.4.1.16:26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	203	356	3.3e-65	0.9938650306748467

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396286	Chitin_synth_1	9.04e-94	203	356	1	163	Chitin synthase. This region is found commonly in chitin synthases classes I, II and III. Chitin a linear homopolymer of GlcNAc residues, it is an important component of the cell wall of fungi and is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases.
133033	Chitin_synth_C	2.12e-92	199	513	1	244	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
400626	Chitin_synth_1N	3.29e-32	125	202	1	70	Chitin synthase N-terminal. This is the N-terminal domain of Chitin synthase (pfam01644).
224136	BcsA	7.31e-24	278	652	91	407	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133045	CESA_like	2.11e-18	199	425	1	167	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAL85387.1|GT2|2.4.1.16	0.0	1	877	1	889
CAA63929.1|GT2|2.4.1.16	0.0	1	877	1	889
BAE60315.1|GT2	0.0	1	877	1	893
BAB85683.1|GT2	0.0	1	877	1	893
QRD89452.1|GT2	0.0	1	877	1	893

PDB Hits     

P174DRAFT_457138-t37_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P29070|CHS1_NEUCR	0.0	103	877	122	917	Chitin synthase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=chs-1 PE=3 SV=2
sp|P30602|CHS3_EXODE	0.0	105	833	117	864	Chitin synthase 3 OS=Exophiala dermatitidis OX=5970 GN=CHS3 PE=3 SV=2
sp|P54267|CHSG_ASPFU	0.0	37	877	30	911	Chitin synthase G OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=chsG PE=2 SV=2
sp|Q00757|CHSB_EMENI	0.0	55	877	84	916	Chitin synthase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=chsB PE=2 SV=2
sp|Q92197|CHSC_ASPFU	0.0	1	877	1	893	Chitin synthase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=chsC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000039	0.000000

TMHMM  Annotations     

Start	End
506	525
548	570
590	612
625	647
673	695
702	724
806	823
843	865