CAZyme Information: P174DRAFT_456775-t37_1-p1

Basic Information

• Species: Aspergillus novofumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus novofumigatus
• CAZyme ID: P174DRAFT_456775-t37_1-p1
• CAZy Family: GH5
• CAZyme Description: putative feruloyl esterase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
272	MSZS01000001|CGC3	28737.41	8.2451

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnovofumigatusIBT16806	11729	1392255	197	11532

• Gene Location: location=MSZS01000001:3970826-3971644(-)

Full Sequence      

MIPNMIYSAILALSALAPSVLAETRSSGCGKQPSLTNGVHNINGREYILKVPDNYDKNKA
HHLVFGLHWRGGNMWNVVDGRSVQPWYGLETRAQGSTIFVAPNGKNAGWANNGGEDVAFI
DAIIKQVEGDLCVDQSSRFATGFSWGGGMSYSLACSRAKQFKAVSVLSGGVISGCDGGND
PIAYLGIHGINDGVLPFQGGVNLAQKFVKNNRCQQTNIGTPQPGSHGSVRTDFKGCSKPV
SFIAYDGGHDAAPLGVGSSLAPDATWKFFMAA

Enzyme Prediction     

No EC number prediction in P174DRAFT_456775-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	45	173	9.3e-21	0.5814977973568282

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226040	LpqC	5.28e-17	40	269	42	304	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].
223489	DLH	3.34e-05	120	196	96	173	Dienelactone hydrolase [Secondary metabolites biosynthesis, transport and catabolism].
226584	COG4099	1.15e-04	47	206	176	340	Predicted peptidase [General function prediction only].
223477	YpfH	0.005	57	205	14	170	Predicted esterase [General function prediction only].
224423	DAP2	0.005	42	171	378	507	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EGX54170.1|CBM1|CE0	1.05e-87	26	269	94	352
QSB17085.1|CBM2|CE0	6.53e-87	26	269	36	285
AYC36484.1|CBM2|CE0	2.18e-83	18	269	36	302
QUC63414.1|CBM2|CE0	4.76e-83	22	269	34	296
AWT41099.1|CBM2|CE0	7.35e-82	9	269	29	308

PDB Hits     

P174DRAFT_456775-t37_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DI08|FAEC_NEOFI	3.05e-200	1	272	1	272	Probable feruloyl esterase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=faeC PE=3 SV=1
sp|A4D9B6|FAEC_ASPFU	1.28e-192	1	272	1	272	Probable feruloyl esterase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=faeC PE=3 SV=1
sp|B0XU32|FAEC_ASPFC	1.28e-192	1	272	1	272	Probable feruloyl esterase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=faeC PE=3 SV=1
sp|A1C9D4|FAEC1_ASPCL	7.81e-178	1	272	1	272	Probable feruloyl esterase C OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=faeC-1 PE=3 SV=1
sp|A1CC33|FAEC2_ASPCL	5.00e-158	1	272	1	272	Probable feruloyl esterase C OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=faeC-2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000256	0.999721	CS pos: 22-23. Pr: 0.9795

TMHMM  Annotations     

There is no transmembrane helices in P174DRAFT_456775-t37_1-p1.