CAZyme Information: P174DRAFT_455713-t37_1-p1

Basic Information

• Species: Aspergillus novofumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus novofumigatus
• CAZyme ID: P174DRAFT_455713-t37_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
445	MSZS01000001|CGC32	50705.52	7.8065

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnovofumigatusIBT16806	11729	1392255	197	11532

• Gene Location: location=MSZS01000001:131113-132548(+)

Full Sequence      

MQRSWNSWCSLRRTILTVAIGACGVFIYLIWFGMNSDPGHCTCQSSTSFQCADCLTCLAS
APPLEQDHVATWSFQYGRDDQNLGLSQSQCQAAFPGLFQDIHRGVEYWKSRGGISRDDLN
TIPFKDGMARAIISNGDLYVVATRAKGDDHRRKIVGTLGSIHRALSASANRTSHPTIEFI
FSIEDRVDDVNAVGHPVWVLSRKASEESVILMPDFGFWSWAKSNIGPYGQVVERIMATES
KLKFADKEQKLVWRGKLSFAPKLRRALLDIARGKPWSDVKELDWSKKANFLLMEDHCRYM
FIGHIEGRAYSASLKYRQACRSVVVAHKLQYIQHHHYLLVASGPEQNYLEVERDFSDLPR
RMDELLQNPDKAERIANNSVKTFRERYLTPAAEACYWRALWEGWAEVSANVTSDVERPPA
DRGLRYESFVLMDSNDMFKYSFGSE

Enzyme Prediction     

No EC number prediction in P174DRAFT_455713-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	175	406	1.2e-20	0.972

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
310354	Glyco_transf_90	5.90e-24	86	419	2	331	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.
214773	CAP10	7.24e-20	175	405	3	250	Putative lipopolysaccharide-modifying enzyme.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR90563.1|GT0	1.83e-196	6	440	15	474
BCS06430.1|GT0	4.39e-179	27	440	31	458
BCR93809.1|GT0	4.39e-179	27	440	31	458
QMW31874.1|GT0	6.23e-179	12	440	12	454
QRD90937.1|GT0	6.23e-179	12	440	12	454

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5F84_A	8.14e-06	191	407	149	378	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]

Swiss-Prot Hits     

P174DRAFT_455713-t37_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999987	0.000001

TMHMM  Annotations     

Start	End
13	32