CAZyme Information: P174DRAFT_454015-t37_1-p1

Basic Information

• Species: Aspergillus novofumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus novofumigatus
• CAZyme ID: P174DRAFT_454015-t37_1-p1
• CAZy Family: GH43|CBM91
• CAZyme Description: putative acetyl xylan esterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
358		37983.15	7.8907

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnovofumigatusIBT16806	11729	1392255	197	11532

• Gene Location: location=MSZS01000007:1850610-1851792(+)

Full Sequence      

MRALSLFFALFCFLVISSASPGQDVVKRVTSGSLQQVTNFGSNPSGTLMYIYVPKNLATK
PGIVVAIHYCTGTAQAYYTGSPYAQLAEQYGFIVIYPQSPYSGTCWDVSSQSALTHNGGG
DSNSIANMVTWTISQYNADTSKVFVTGSSSGAMMTNVMAATYPELFAAATVYSGVSAGCF
YSTANQVDAWNSSCAQGNVISTPEVWGGIAKAMYPGYTGPRPRMQIYHGSTDTTLYPQNY
YETCKQWAGVFGYNYNSPQSTQSNTPQANYQTTNWGPNLQGIFATGVGHTVPIHGAQDME
WFGFAGGSSTTTTKTTSTSTTTSSGGSSTTTGVAAHWGQCGGNGWTGRPFARVGMPAR

Enzyme Prediction     

EC	3.1.1.72:7

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	49	234	6.9e-21	0.7400881057268722

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
273828	esterase_phb	2.53e-39	49	252	1	199	esterase, PHB depolymerase family. This model describes a subfamily among lipases of the ab-hydrolase family. This subfamily includes bacterial depolymerases for poly(3-hydroxybutyrate) (PHB) and related polyhydroxyalkanoates (PHA), as well as acetyl xylan esterases, feruloyl esterases, and others from fungi. [Fatty acid and phospholipid metabolism, Degradation]
402228	Esterase_phd	1.53e-23	51	239	5	187	Esterase PHB depolymerase. This family of proteins include acetyl xylan esterases (AXE), feruloyl esterases (FAE), and poly(3-hydroxybutyrate) (PHB) depolymerases.
226040	LpqC	7.30e-21	29	292	29	277	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].
224423	DAP2	3.28e-11	48	176	381	508	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].
226584	COG4099	4.74e-08	26	174	152	302	Predicted peptidase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAM93261.1|CBM1|CE1|3.1.1.72	1.35e-199	1	354	1	368
QBA31203.1|CBM1|CE1	4.44e-188	1	347	1	358
ADX07526.1|CE1	6.27e-176	26	305	21	300
AMQ81177.1|CE1	5.72e-168	25	305	25	303
AAK60128.1|CE1|3.1.1.72	5.72e-168	25	305	25	303

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5X6S_A	1.95e-167	31	305	1	275	Acetyl xylan esterase from Aspergillus awamori [Aspergillus awamori],5X6S_B Acetyl xylan esterase from Aspergillus awamori [Aspergillus awamori]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DBP9|AXE1_NEOFI	2.23e-234	1	347	1	347	Probable acetylxylan esterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=axeA PE=3 SV=1
sp|Q4WBW4|AXE1_ASPFU	2.32e-223	1	347	1	350	Probable acetylxylan esterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=axeA PE=3 SV=1
sp|Q8NJP6|AXE1_TALPU	2.40e-200	1	354	1	368	Acetylxylan esterase A OS=Talaromyces purpureogenus OX=1266744 GN=axeA PE=1 SV=1
sp|Q96W96|AXE1_ASPFI	1.02e-168	25	305	25	303	Acetylxylan esterase A OS=Aspergillus ficuum OX=5058 GN=axeA PE=1 SV=1
sp|A2QZI3|AXE1_ASPNC	1.68e-167	25	305	25	303	Probable acetylxylan esterase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=axeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000221	0.999747	CS pos: 19-20. Pr: 0.9859

TMHMM  Annotations     

There is no transmembrane helices in P174DRAFT_454015-t37_1-p1.