CAZyme Information: P174DRAFT_449448-t37_1-p1

Basic Information

• Species: Aspergillus novofumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus novofumigatus
• CAZyme ID: P174DRAFT_449448-t37_1-p1
• CAZy Family: GH43
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
372	MSZS01000003|CGC8	42296.15	6.4431

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnovofumigatusIBT16806	11729	1392255	197	11532

• Gene Location: location=MSZS01000003:363164-364350(-)

Full Sequence      

MVEKKFVPISLFPKRARRFTHGSLATLFLFIYFCVTRTSHHVGETRSYSTQATADVGEKF
PRKIWQIWKVNPLEFDGRDIEVARSWTAKNPGYRYEVLTDQNDLEYVETNFGPLGENRPD
IVETYRSLTAPIIKADLLRYLVMYIEGGVYADIDVEALRPVERFVPSTHDERDIGMVIGV
EIDEPQFSDHPILGQKSQSFCQWTFMCKPRQPVMMRLVENILHWLNELSIKQGKPISELQ
LDFDDVITGTGPSAFTGAILSEMSRITGKTVTWDTFHDIPESKVVGGFLVLTVEAFAAGQ
GHSDSGTHNSRNALVKHHYHASEWPKRHPDSITPFLGRLRSEEQERQIAIFQAIGEALKK
MEPPPQPAFGGF

Enzyme Prediction     

No EC number prediction in P174DRAFT_449448-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	83	166	2.7e-20	0.9

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	4.47e-24	55	221	77	243	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.47e-14	78	160	3	82	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP95522.1|GT32	5.73e-217	1	364	1	385
QMW40889.1|GT32	7.00e-170	13	354	7	368
BAE58544.1|GT32	7.00e-170	13	354	7	368
UDD56882.1|GT32	7.00e-170	13	354	7	368
QMW28814.1|GT32	1.41e-169	13	354	7	368

PDB Hits     

P174DRAFT_449448-t37_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	1.12e-33	67	324	146	393	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	3.14e-30	49	322	88	374	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P47124|HOC1_YEAST	4.61e-28	59	296	129	361	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	2.31e-21	61	322	97	468	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	1.20e-07	48	162	50	150	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000006	0.000031

TMHMM  Annotations     

There is no transmembrane helices in P174DRAFT_449448-t37_1-p1.